KEGG   Bacillus cereus B4264: BCB4264_A2523Help
Entry
BCB4264_A2523     CDS       T00805                                 

Definition
(GenBank) serine-type D-Ala-D-Ala carboxypeptidase
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
bcb  Bacillus cereus B4264
Brite
KEGG Orthology (KO) [BR:bcb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BCB4264_A2523
Enzymes [BR:bcb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BCB4264_A2523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 SPRY Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: ACK59959
UniProt: B7H7X0
LinkDB All DBs
Position
complement(2442781..2443797)
Genome map
AA seq 338 aa AA seqDB search
MQFLKKFAILLLSFFITALIVLYFYLYVNGPIIQAKSAILINANSGEIVYKKNEETPVQS
AALSKLMTEYIVLEQLNDRKIQLDDLVQISNEVFRVETSPIQVTSNDKTTVRDLLHALLL
AGNNRSALALAEHIAGNEDNFTVLMNKKAKELKLLQPSPFLNSTGINNNTNKQSTTTAID
AAKLAARLVKDFPDVLNITKLTSYQFTFKDSQVFNTNKMIYSLNENIKLQGVDGLQTSFS
TNGNYSFVSTAKLGDTRLISVILDADEENISFIETKKLLQYGFDPSSYSALQAFKDALTS
WTILLQFKNLIIQTIMIFLIITTLMFLHIRQKKSEDFN
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcaattcttaaagaaattcgctattttattattatctttttttattactgcacttatc
gttttatatttttatctttatgtaaatggtccgattattcaagctaaatcagctatttta
ataaatgctaattcaggtgaaattgtttataaaaaaaatgaagaaactccagtacaatca
gctgctttatctaaattaatgacagaatatatcgtattggagcaactaaatgatagaaaa
atacagttagatgacttagtacaaataagtaacgaagttttccgagtagaaacaagccct
atacaagtaacatcgaatgataaaacaacggttcgtgatttacttcatgcattgctactg
gcagggaataatcgttctgcactcgccctagcagaacacattgctggaaatgaagataac
tttacagtattaatgaataaaaaagcaaaagaactaaagttattacaaccatctccattt
ctaaactctactggaattaataataatacaaataaacaatcaactacaacagcgatagac
gcagctaaactagcagcacgattagtaaaagattttccagatgtattgaatattacgaaa
ctaacctcttaccaatttaccttcaaagattcccaggttttcaatacgaataaaatgata
tattcccttaatgaaaacattaaacttcaaggtgttgatggcttacaaactagtttttca
actaacggtaattatagttttgtcagtacagcaaaacttggagatactagactaatttca
gtaatattagatgcagatgaagaaaacatttcatttattgaaacaaaaaagttgctccag
tatggttttgatccttcctcgtactctgcactccaagcttttaaagacgcccttacatct
tggacaatattgcttcagtttaaaaatttaattatacaaactataatgatttttttaatc
attaccaccttaatgtttttacatatacgtcagaaaaaatccgaggatttcaattaa

DBGET integrated database retrieval system