KEGG   Bacillus cereus B4264: BCB4264_A4346Help
Entry
BCB4264_A4346     CDS       T00805                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bcb  Bacillus cereus B4264
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YqzE
Motif
Other DBs
NCBI-ProteinID: ACK61638
UniProt: B7HCK6
LinkDB All DBs
Position
complement(4223896..4224096)
Genome map
AA seq 66 aa AA seqDB search
MSTNDYVRFVTQQFVSYMDAPKEDRKQKKEQRRAEKEPFMNKWFGVMPLSAALFYRNVKS
KRKKSS
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgtctactaatgattatgttcgctttgtgacgcagcagtttgtgtcgtatatggatgct
ccaaaagaagatcgaaaacaaaagaaagaacaacgccgtgctgaaaaagagccatttatg
aataagtggtttggtgttatgccgctgagtgctgctttgttttaccgaaatgtaaaaagt
aaaagaaaaaaatcaagttga

DBGET integrated database retrieval system