KEGG   Bacillus cereus B4264: BCB4264_A4347Help
Entry
BCB4264_A4347     CDS       T00805                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
bcb  Bacillus cereus B4264
Pathway
bcb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bcb01100  Metabolic pathways
bcb01110  Biosynthesis of secondary metabolites
bcb01130  Biosynthesis of antibiotics
bcb01230  Biosynthesis of amino acids
Module
bcb_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bcb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCB4264_A4347 (aroK)
Enzymes [BR:bcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     BCB4264_A4347 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_17 Cytidylate_kin2 AAA_33 Cytidylate_kin dNK Thymidylate_kin AAA ABC_tran
Motif
Other DBs
NCBI-ProteinID: ACK63011
UniProt: B7HCK7
LinkDB All DBs
Position
complement(4224135..4224605)
Genome map
AA seq 156 aa AA seqDB search
MGAGKTTIGKALSKELQMDVVDTDQKIEEKQEKAIRNIFAEEGEMAFREYESEMLRALPV
HNVIITTGGGIIERAENRKWMKENGTVVYLYCDPHVIAERLREDTTRPLFQKKDIDAFVT
KFESRRAYYEEAHIHIDTTNKSVKQIMNELKEKINV
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgggagcagggaaaacaacaattggaaaagcgttaagtaaagaacttcaaatggatgtt
gtagatactgatcaaaaaatcgaagagaagcaagagaaggcaattcgaaatatttttgcc
gaagaaggggaaatggcttttcgggaatatgaaagcgaaatgttacgtgcgctaccagtc
cataatgtcattattacaactggtgggggaattattgaacgagcggaaaatcgcaagtgg
atgaaagagaacggaactgtcgtgtatttatattgcgatccgcatgtaattgcagaaagg
cttcgtgaagatacgacacgtccactatttcaaaagaaagatatagatgcatttgtaacg
aaatttgaatcacgccgagcttattatgaagaggctcatatacatattgatacgacgaat
aagtctgtaaagcaaattatgaatgaattaaaggaaaagattaatgtataa

DBGET integrated database retrieval system