KEGG   Bacillus cereus B4264: BCB4264_A4624Help
Entry
BCB4264_A4624     CDS       T00805                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase, iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bcb  Bacillus cereus B4264
Pathway
bcb00020  Citrate cycle (TCA cycle)
bcb00190  Oxidative phosphorylation
bcb00650  Butanoate metabolism
bcb01100  Metabolic pathways
bcb01110  Biosynthesis of secondary metabolites
bcb01120  Microbial metabolism in diverse environments
bcb01130  Biosynthesis of antibiotics
bcb01200  Carbon metabolism
Module
bcb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCB4264_A4624 (sdhB)
   00650 Butanoate metabolism
    BCB4264_A4624 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BCB4264_A4624 (sdhB)
Enzymes [BR:bcb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BCB4264_A4624 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     BCB4264_A4624 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_10 Fer4_9 Fer4_16 Fer4_17 Fer4_2 Fer4 Fer4_4 Fer4_3 Fer4_13
Motif
Other DBs
NCBI-ProteinID: ACK61354
UniProt: B7HF29
LinkDB All DBs
Position
complement(4479942..4480703)
Genome map
AA seq 253 aa AA seqDB search
MSEKTIRLIITRQDGPDAQAFDQEFEIPYRPNMNIISALMEIRRNPVDSKGNQTTPIAWD
MNCLEEVCGACSMVINGKPRQSCTALIDQLEQPIRLKPMKTFPVVRDLQVDRSRMFNALK
RVKAWIPIDGTYDLGPGPRMPEKKRQWAYELSKCMTCGVCLESCPNVNSKSDFIGPAPLS
QARLFNSHPTGEMHKADRLRAIMGDGGLANCGNSQNCVQSCPKGIPLTTSIAALNRDTTI
QSFKDFFGSDNNY
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaaaacaatccgcctcatcattacgagacaagacgggccagatgcgcaagcg
tttgaccaagaatttgaaattccatatcgtccgaatatgaatattatctcagcacttatg
gaaatccgtcgtaatcctgttgattcaaaagggaaccaaacaactccgattgcatgggat
atgaactgcttagaggaagtatgtggtgcatgttcgatggtgattaacggaaaaccacgt
caatcatgtacggcacttattgatcaattagagcaaccaattcgcttaaaaccgatgaag
acattcccggttgtacgtgacttacaagttgatcgtagtcgcatgtttaatgctctaaaa
cgcgttaaagcgtggattccaattgatggtacgtatgacctaggtccaggaccaagaatg
cctgagaaaaagcgtcaatgggcttatgagctttcaaaatgtatgacatgtggtgtttgc
ttagaatcatgtccaaacgtaaacagtaagtctgactttattggaccagcaccgttatca
caagctcgcttattcaactcacatccaacgggtgaaatgcataaagcagatcgcttacgt
gcaattatgggagatggaggactagcaaactgtggtaactctcaaaactgtgtgcaatca
tgtccgaagggtattcctttaacaacttcaattgcggcattaaaccgtgatacaacaatt
caatcgttcaaagatttctttggtagcgataataactattaa

DBGET integrated database retrieval system