KEGG   Bacillus cereus B4264: BCB4264_A4625Help
Entry
BCB4264_A4625     CDS       T00805                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bcb  Bacillus cereus B4264
Pathway
bcb00020  Citrate cycle (TCA cycle)
bcb00190  Oxidative phosphorylation
bcb00650  Butanoate metabolism
bcb01100  Metabolic pathways
bcb01110  Biosynthesis of secondary metabolites
bcb01120  Microbial metabolism in diverse environments
bcb01130  Biosynthesis of antibiotics
bcb01200  Carbon metabolism
Module
bcb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCB4264_A4625 (sdhA)
   00650 Butanoate metabolism
    BCB4264_A4625 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BCB4264_A4625 (sdhA)
Enzymes [BR:bcb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BCB4264_A4625 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     BCB4264_A4625 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored AlaDh_PNT_C NAD_binding_8 FAD_binding_3 DUF4827
Motif
Other DBs
NCBI-ProteinID: ACK59053
UniProt: B7HF30
LinkDB All DBs
Position
complement(4480696..4482489)
Genome map
AA seq 597 aa AA seqDB search
MKGKLIVVGGGLAGLMATIKAAEAGVNVELFSLVPVKRSHSVCAQGGINGAVNTKGEGDS
PWIHFDDTIYGGDFLANQPPVKAMCEAAPGIIHLMDRMGVMFNRTEEGLLDFRRFGGTQH
HRTAFAGATTGQQLLYALDEQVRRHEVAGLVTKYEGWDFLRAVVDDEGVCRGIVAQDLQT
MEIRSFGADAVIMATGGPGIIFGKSTNSIINTGTAASAVYQQGAYYANGEFIQIHPTAIP
GDDKLRLMSESARGEGGRVWTYKDGKPWYFLEEKYPAYGNLVPRDIATREIFDVCVEQKL
GINGENMVYLDLSHKDPKELDIKLGGIIEIYEKFTGDDPRKLPMKIFPAVHYSMGGLWVD
YKQMTNIPGLFAAGECDYSMHGGNRLGANSLLSAIYGGMVAGPNAIEYMKGLSKSSDAVS
STVYEQNELIETEKFNNILTMDGNENAYVLHKELGEWMTDNVTVVRENKKLLETDAKIEE
LMARYKRININDTARWSNQGASFTRQLANMFELARVITIGAYNRNESRGAHYKPEFPNRD
DANFLKTTMAKFEGEGNAPAFHYEDVDISLIKPRKRDYSSKHDVAAKGEEKGDKQHV
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggaaacttatagtagtcggcggtggcttggctggcttaatggcaacgattaaa
gcggcagaagcaggagtaaatgttgaactgttttctttagtaccagtaaaacgttcacat
tctgtatgtgctcagggcggaattaacggtgccgtaaatacgaaaggtgaaggggattct
ccatggatccactttgacgatacaatttatggtggggacttcttagcgaaccaaccacca
gttaaagcaatgtgtgaagcagcacctggtatcattcatttaatggaccgtatgggtgtt
atgttcaaccgtacggaagaaggacttcttgatttccgtcgatttggtggaacgcaacat
caccgtacagcatttgctggtgcaacaactggacagcaattactttacgcattagatgag
caagtacgtcgtcacgaagtagcaggacttgtaacgaaatatgaaggttgggatttctta
cgagctgttgttgatgatgaaggtgtgtgccgaggaatcgttgcacaagacttacaaact
atggagattagaagtttcggagcagatgccgtgattatggcaacagggggccctggtatc
attttcggaaaatcaacaaactccattatcaatacaggtacagcagcttctgctgtatat
caacaaggcgcatattatgcaaacggtgagttcattcaaattcacccaacggcaattcct
ggagacgataaattacgtcttatgagtgaatctgcacgtggtgaaggtggacgtgtttgg
acatataaagatggtaaaccatggtacttcttagaagaaaaatatccggcttacggaaac
cttgtacctcgtgacatcgcaacgcgtgaaatctttgatgtttgcgtagagcaaaaacta
ggtattaacggtgaaaacatggtgtacttagatctttctcataaagatccaaaagaacta
gatattaaactaggtggaattattgaaatctatgagaaatttacaggggatgatcctcgt
aaactaccgatgaaaatcttcccagctgttcactattcaatgggcggactatgggttgat
tataaacagatgacaaatattccaggtttatttgcagcaggtgagtgtgattattctatg
cacggtggtaaccgtcttggtgcgaactcactattatcagcaatttatggtggtatggta
gcaggaccaaacgcaattgagtatatgaaaggtctttctaaatcatctgatgctgtttca
tctactgtatatgagcaaaatgaattaatcgaaacagagaaatttaacaatattttaacg
atggatggtaacgaaaatgcgtatgttcttcataaagagcttggagaatggatgacagat
aacgttacagtagttcgtgaaaataaaaaattattagaaacagatgcgaaaattgaagaa
ttaatggctcgttacaaacgtattaacattaacgatacagcaagatggagtaaccaaggt
gcttcatttacacgccaacttgcaaatatgtttgagttagcacgtgttattacaattggc
gcatataaccgtaatgagagccgtggggcgcattacaaacctgaattcccaaatcgtgat
gatgcaaacttcttaaaaactacgatggcaaaatttgagggagaaggaaatgcaccagca
ttccattacgaggacgttgatatttcgttaattaaaccgcgtaaacgtgattattcttca
aaacacgatgtagctgctaagggtgaagagaagggggataaacaacatgtctga

DBGET integrated database retrieval system