KEGG   Bacillus cereus B4264: BCB4264_A4703Help
Entry
BCB4264_A4703     CDS       T00805                                 

Gene name
citC
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bcb  Bacillus cereus B4264
Pathway
bcb00020  Citrate cycle (TCA cycle)
bcb00480  Glutathione metabolism
bcb01100  Metabolic pathways
bcb01110  Biosynthesis of secondary metabolites
bcb01120  Microbial metabolism in diverse environments
bcb01130  Biosynthesis of antibiotics
bcb01200  Carbon metabolism
bcb01210  2-Oxocarboxylic acid metabolism
bcb01230  Biosynthesis of amino acids
Module
bcb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcb_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bcb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCB4264_A4703 (citC)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BCB4264_A4703 (citC)
Enzymes [BR:bcb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BCB4264_A4703 (citC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ACK58745
UniProt: B7HFA7
LinkDB All DBs
Position
complement(4559720..4561012)
Genome map
AA seq 430 aa AA seqDB search
MTTGEKITVTNGVMNVPNNPIIPFIEGDGIGPDIWAAASRVLEAAVEKAYDGEKKIVWKE
VLAGEKAFNQTGEWLPEETLNLIREYLIAIKGPLTTPVGGGIRSLNVALRQELDLYVCLR
PVRYFEGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAQGSPEAEKVLAFLKEAMGVNKIR
FPETSGIGIKPISEEGTKRLVRAAIQYAINEKRSSVTLVHKGNIMKFTEGAFKNWGYEVA
EQEFGDKVFTWAEYDRIVEKDGKDAANKAMADAEVAGKIIVKDSIADIFLQQILTRPREF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYVTGHAIFEATHGTAPKYAGLDKVNPS
SVLLSGVLLLEHLGWNEAAKLVTASVEKTIASKVVTYDFARLMEGATEVKCSEFANELIK
NMDVAIIKNA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
ttgacgacaggtgaaaaaattactgtaactaatggtgttatgaatgtaccaaacaatccg
attattccgtttatcgagggagatggaattggtcctgatatttgggcagctgcatctcgc
gtactagaagcagcagttgaaaaagcttatgatggtgagaagaaaatcgtttggaaagaa
gtgcttgcaggggaaaaagcattcaaccaaacaggcgagtggttaccagaagaaacttta
aacttaattcgtgaatatttaatcgcgattaaaggtccacttacaactccagttggcggt
ggtattcgttctctaaacgtagcacttcgtcaagaattagatttatatgtatgtctacgt
ccagttcgttattttgaaggtgttccttcacctgtaaaacgtccggaagatactgatatg
gttattttccgtgaaaatacagaagacatttatgctggaattgaatatgcgcaaggatct
ccagaagcagaaaaagttcttgctttcttaaaagaagcaatgggtgttaataaaatccgc
ttcccagaaacatctggtattggtattaagccaatttcagaagaagggacaaagcgtctt
gttcgtgctgcaattcaatatgcaattaacgaaaaacgttcttctgttacattagttcat
aaaggaaacattatgaaatttacagaaggtgctttcaaaaactggggttacgaagtagcg
gaacaagaattcggcgacaaagtatttacttgggctgaatacgatcgtatcgttgaaaaa
gatggtaaagatgcagcgaataaagcgatggcagacgctgaagtggctggaaaaatcatc
gtaaaagattctattgcagacatcttcttacaacaaattttaactcgtccacgtgagttc
gatgttgttgcaacaatgaacttaaatggtgactatatctctgatgcacttgctgcacaa
gtaggtggaattggtattgcacctggtgcaaacattaactatgtgactggacatgctatc
tttgaagctacacacggtacagctccaaaatatgcaggtttagataaagtaaacccatct
tctgttcttctttcaggtgtattattattagaacacttaggatggaacgaagctgcgaaa
ttagtaactgcttctgttgagaaaacaattgcttcaaaagtagtaacttatgatttcgca
cgcttaatggaaggtgcaacagaagtgaaatgttctgagttcgctaatgaacttattaaa
aacatggatgtagcgataatcaaaaacgcataa

DBGET integrated database retrieval system