KEGG   Bartonella clarridgeiae: BARCL_0374Help
Entry
BARCL_0374        CDS       T01394                                 

Gene name
sodB
Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bcd  Bartonella clarridgeiae
Brite
Enzymes [BR:bcd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BARCL_0374 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N AsnC_trans_reg
Motif
Other DBs
NCBI-ProteinID: CBI76055
UniProt: E6YGR7
LinkDB All DBs
Position
408182..408784
Genome map
AA seq 200 aa AA seqDB search
MTFKLVELPYDYDALSPYMSRETLEYHHDKHHLAYLTNTNNFIKDLGLENKSLTDIIKET
FGKNPGLFNNAAQYYNHNHFWNWMKKGGGGKKLPAKLAKAIESDLGGYDKFRADFIAAGV
AQFGSGWAWVALKDGKLEIMKTPNGENPLIHDAQPILGVDVWEHSYYIDYRNARPKYLEV
FVDHLINWDYVLELYESYGL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaaattagtcgagttgccttatgattatgatgccctttcgccttatatgtca
cgcgaaacacttgaatatcatcatgataagcatcatcttgcttatcttacaaatactaat
aattttataaaagatttaggcttagaaaataagagtcttacagatattattaaagaaacc
tttggaaaaaatcctggtttgtttaataatgcagctcagtattataatcataatcatttt
tggaattggatgaaaaaaggtggtggtggtaaaaaacttcctgcaaaattagccaaagct
attgaatctgatcttggtggttatgataagtttcgtgcagattttatagcagcaggtgtt
gctcagtttggttctggttgggcatgggttgctcttaaagatggcaaattagaaattatg
aaaacacccaatggtgagaatcctttaattcatgatgcacaacctattctaggtgttgat
gtgtgggagcattcctattatattgattatcgtaatgcacgtccaaaatatttagaggta
tttgtagaccatttaattaattgggattatgttttagaactttatgaaagctatggatta
taa

DBGET integrated database retrieval system