KEGG   Bartonella clarridgeiae: BARCL_0902Help
Entry
BARCL_0902        CDS       T01394                                 

Gene name
tufB
Definition
(GenBank) elongation factor Tu (EF-Tu)
  KO
K02358  elongation factor Tu
Organism
bcd  Bartonella clarridgeiae
Brite
KEGG Orthology (KO) [BR:bcd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bcd03012]
    BARCL_0902 (tufB)
   03029 Mitochondrial biogenesis [BR:bcd03029]
    BARCL_0902 (tufB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcd04147]
    BARCL_0902 (tufB)
Translation factors [BR:bcd03012]
 Eukaryotic Type
  Elongation factors
   BARCL_0902 (tufB)
 Prokaryotic Type
   BARCL_0902 (tufB)
Mitochondrial biogenesis [BR:bcd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BARCL_0902 (tufB)
Exosome [BR:bcd04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BARCL_0902 (tufB)
  Exosomal proteins of breast cancer cells
   BARCL_0902 (tufB)
  Exosomal proteins of colorectal cancer cells
   BARCL_0902 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CBI76583
UniProt: E6YI95
LinkDB All DBs
Position
complement(1001344..1002519)
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERTKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEERARGITIST
AHVEYETESRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSKYDFPGDDIPIVKGSALAALEDSNKS
IGEDSVRLLMSEVDKYIPTPERPVDQPFLMPIEDVFSISGRGTVVTGRVERGVIKVGEEI
EIIGIRPTSKTTVTGVEMFRKLLDQGQAGDNIGALLRGVDREGIERGQVLAKPGSVTPHT
KFKAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVAMDVSL
IVPIAMEEKLRFAIREGGRTVGAGIVSKIIE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagcaaatttgaacgtacgaagccgcatgttaatataggtacgattggtcac
gttgatcatgggaagacttcattgacagcagcgattacgaagtattttggtgaatttaaa
gcatatgatcaaattgatgcagcccctgaggagcgtgctcgtggtataacgatatctact
gcgcatgttgagtatgaaacggagagtcgtcactatgcccatgttgattgtcctggtcat
gcggattatgttaagaacatgattacaggggctgcgcaaatggatggagctatattggtt
gtttctgcagcggatggtcctatgcctcagactcgggagcatattttgttggcacgtcag
gttggtgttccagcgattgttgtttttctaaataaagttgatcaggttgatgatgcagag
cttttagagcttgttgaacttgaggttcgagaacttttatcgaaatatgattttcctggg
gatgatattcccatagttaaagggtcagctttagcagcccttgaggattctaataagagt
ataggggaagattccgttcgtcttttgatgagtgaagttgataagtatataccgacacct
gaacgtccagttgatcaaccgtttttgatgcctattgaagatgtattttccatatctggt
cgtggtacggttgttacaggtcgtgttgagcgtggtgttattaaagttggtgaagaaata
gagattatcggtattcgtcctacgtctaagacgacagtcaccggggttgaaatgtttcgt
aagcttttggatcaaggtcaggctggtgataatattggagctttgcttcgtggtgttgat
cgtgaagggattgagcgtggtcaggtgttggcaaagcctggttctgttacgccgcatact
aagtttaaagctgaggcctatattttaacgaaagatgaaggtggtcgtcacacaccgttt
ttcacgaattatcgtccgcaattttattttcgtacgacagatgtcaccggtatagttacg
ttgcctgagggcacagaaatggttatgccaggtgataatgtcgctatggatgtttctttg
attgtgccgattgcaatggaggagaagctccgttttgcaattcgagaaggtggccgtacc
gttggggctggtatcgtatctaaaatcattgaataa

DBGET integrated database retrieval system