KEGG   Bacillus cereus ATCC 14579: BC0257Help
Entry
BC0257            CDS       T00127                                 

Gene name
ddl
Definition
(RefSeq) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00473  D-Alanine metabolism
bce00550  Peptidoglycan biosynthesis
bce01100  Metabolic pathways
bce01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bce00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BC0257 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BC0257 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BC0257 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bce01011]
    BC0257 (ddl)
Enzymes [BR:bce01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BC0257 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:bce01011]
 Precursor biosynthesis
  Amino acid ligase
   BC0257 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 GARS_A ATP-grasp_3
Motif
Other DBs
NCBI-GeneID: 1202610
NCBI-ProteinID: NP_830125
UniProt: Q81IU1
LinkDB All DBs
Position
230894..231979
Genome map
AA seq 361 aa AA seqDB search
MTKIKLGLLYGGKSAEHQVSLQTALAAIKALNQDKFEIHPIYITEQGQWVRGERIEGEVT
DVEALKMSGAENAISPLSLSTEIIPSAASEENAIDVIFPLLHGPNGEDGTVQGLLELMNI
PYVGNGVLASSAGMDKVVMKNIFAEAGLKQAKYASFIRSAWEKNREEAYSKVEDKLGYPC
FVKPANLGSSVGINKCKNREELEDAFVEAFQFDRKIIVEENIVGREVEVGVLGNDEPKCS
VVGEIVPKKDFYDYKSKYIDGDTALIIPAEMTEEESNVIKRDAIIAFQSLDGAGLTRADF
FLTKDGEVYINEVNTMPGFTPFSMFPLLWQHTGLPYPELIEELIRLAIERHEEKQKIKYT
I
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
ttgacgaaaattaaattaggtttattatatggtggaaaatcagctgagcatcaagtttcg
ctacagacggctcttgctgctattaaagcgttaaatcaagataaattcgagattcatcca
atttatattacagaacaaggtcaatgggtacgtggtgagcgtattgaaggcgaagtaaca
gatgttgaagctttaaaaatgagcggtgcagaaaatgcgatttctccgttatcattaagt
acagaaattatcccatctgcagcttctgaggagaacgctattgacgttattttcccatta
ctacatggaccaaacggtgaagatggaacggttcaaggactattagaattaatgaatatc
ccttatgtaggaaatggtgttctagcatcatctgctggtatggataaagttgttatgaaa
aacatctttgcagaggctggtttaaaacaagcaaaatatgcatccttcattcgtagtgca
tgggaaaaaaatcgtgaggaagcttattctaaagtagaagataagttaggatatccttgc
ttcgtaaaaccagcgaaccttggttcaagtgttggtattaataagtgtaaaaatcgtgaa
gaacttgaggatgcatttgtagaggcattccaatttgatcgcaaaattattgtagaagaa
aatattgtaggtcgtgaagtagaagttggggtactaggtaatgatgagccgaaatgttca
gttgtaggtgaaatcgttccgaaaaaggacttctatgattataagtcgaaatatatcgat
ggtgatacggcgctaattattccagctgaaatgacagaagaagaatctaatgtaattaag
cgtgatgcgattattgcattccaatcattagacggtgcaggtttaacgcgagctgatttc
ttcttaacgaaagatggagaagtgtatattaacgaagtaaacacaatgccaggatttaca
ccgttcagtatgttccctctattatggcaacatactgggttaccgtatccagaattaatc
gaagagctaattcgtttagcgattgaacgtcacgaagaaaaacaaaaaattaaatataca
atctaa

DBGET integrated database retrieval system