KEGG   Bacillus cereus ATCC 14579: BC2941Help
Entry
BC2941            CDS       T00127                                 

Definition
(RefSeq) chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bce01100  Metabolic pathways
bce01110  Biosynthesis of secondary metabolites
bce01130  Biosynthesis of antibiotics
bce01230  Biosynthesis of amino acids
Module
bce_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BC2941
Enzymes [BR:bce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     BC2941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt
Motif
Other DBs
NCBI-GeneID: 1205289
NCBI-ProteinID: NP_832688
UniProt: Q81C42
LinkDB All DBs
Position
complement(2900058..2901230)
Genome map
AA seq 390 aa AA seqDB search
MRYITAGESHGPQLTVILEGVPAGLTLTAEHINKELLRRQKGHGRGRRMQIETDTVEIVS
GVRHGMTLGSPITLIVKNDDFKHWTKVMGAEPISEKESKDMKRTITKPRPGHADLNGAIK
YGHRDIRNVLERSSARETTVRVAAGAVAKQILSELGVEIAGHVLEIGGVKAKHISNLSIE
EIQTITENSPVRCLDKEVEQEMMNAIDNAKSSGDSIGGIVEVIAEGMPIGVGSYVHYDRK
LDAKLAGAIMSINAFKGAEIGVGFEAARQPGSKVHDEILWDEEKGYTRRTNNAGGLEGGM
TTGMPIIVRGVMKPIPTLYKPLASVDIDTKEAFQASIERSDSCAVPAAGVVAESVVAWEL
ADALVEQFGKDRMELLKQNIMQHNNYAKEF
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagatacattacagctggagaatcacatggaccgcagttaacagttattttagaaggt
gtaccagcaggtttgacacttacggcggaacatattaataaagaattattaagaagacaa
aaaggtcatggacgcggaagacgtatgcaaattgaaacagatacagttgaaattgtaagt
ggtgttcgtcacgggatgacacttggatcaccgattacgttaattgtaaaaaatgatgat
ttcaaacattggacgaaagtaatgggtgcagagccaatttcggaaaaagaaagtaaagac
atgaaacgtacaattacaaaaccacgtcccggacatgcagatttaaatggagcaattaaa
tatggtcatcgtgatataagaaacgtattagagcggtcatctgcaagagaaacgacagtt
cgtgtagctgctggtgcagttgcaaaacaaattttaagcgaattaggcgtggaaattgca
ggacatgttcttgaaattggtggagtaaaagcaaaacatatttcaaacttatcaattgaa
gaaattcaaacaattactgaaaactcaccagttcgatgtttagataaagaagtagagcaa
gaaatgatgaatgcgattgacaacgcaaaaagtagtggagattcaatcggtggtattgtg
gaagtcattgcagaaggtatgccgattggcgtcggtagttacgtccattacgatcgtaaa
ttagatgcaaaacttgctggtgcaattatgagtataaatgcatttaaaggtgctgaaatc
ggcgtaggttttgaagcggcacgacaaccaggaagcaaagtgcatgatgaaattctgtgg
gatgaagaaaaaggatacacgagaagaacgaataatgccggcggtttagaaggcggtatg
acaacaggtatgccaattatcgtaagaggcgtgatgaagccaattcctactttatacaaa
ccgttagcaagcgttgatattgatacgaaagaagcattccaagcgagtattgaaagatct
gatagttgcgcagtaccagcggcgggtgtagtagctgaatctgttgtggcatgggaactt
gcagatgcactagtcgaacaattcggaaaagatcgtatggaattattaaaacaaaacatt
atgcaacacaataactacgcaaaagaattttaa

DBGET integrated database retrieval system