KEGG   Bacillus cereus ATCC 14579: BC3013Help
Entry
BC3013            CDS       T00127                                 

Definition
(RefSeq) D-alanyl-D-alanine carboxypeptidase
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
bce  Bacillus cereus ATCC 14579
Brite
KEGG Orthology (KO) [BR:bce00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BC3013
Enzymes [BR:bce01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BC3013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Beta-lactamase2
Motif
Other DBs
NCBI-GeneID: 1205361
NCBI-ProteinID: NP_832759
UniProt: Q81BX5
LinkDB All DBs
Position
complement(2976510..2977676)
Genome map
AA seq 388 aa AA seqDB search
MKKCNSIKLASFAVLLAGTALFTPGFTVTAESTQNISSSSQVHDQKNRNGWKQVMQETVQ
LGAVGILAKASNNGKTNSFTAGVADLSTKKPVNSDYRFRIGSVTKTFTATTILQLVGENR
LQLDDPIEKWLPGLVQGNGYDGNQITIRQLLNHTSGIAEYLKSKDADIMNSKKTYTAEEI
VKIGLSLPPDFSPGKDWLYSNTGYVILGMLIEKITGNSYAEEIEKRIIEPLDLSNTFLPG
NSPVIPGKNHARGYVKMEGTGELKDITYYNPSLANAAGDMISNADDLNKFFSSLLGGKLL
KERELKEMLTTVPIEGKGVGDAYGLGIYETKLPNGVSVWGHGGGIPGFTTFAGGVIGGKH
TLAISLNSIGGVDIVPQFNKMMQIEFNK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatgtaattcaattaagttagcaagttttgcagttttattagcgggtactgct
ctattcacacctggttttactgtgactgcagagtcaacccaaaatatttctagttcgtca
caagtacatgatcaaaagaatcgtaatggctggaaacaagtaatgcaggaaacagtacag
cttggtgctgtaggaatattagctaaggcgtctaataacggaaaaactaatagttttact
gcaggcgtggcggacttaagtacaaagaaaccggtgaattcggattatcgctttcggatt
ggtagtgtgacgaagacgtttactgccacgactattcttcaattagtaggagaaaatcgc
ttacaacttgacgatccaattgaaaagtggctaccgggtctcgtgcaaggaaatgggtat
gatggtaatcaaattacgatacgacaacttttgaatcatacgagtggtatcgctgaatac
ttaaagtcaaaagacgcggacataatgaattcgaaaaaaacgtatacagcagaagaaata
gtgaaaataggcctttcgctgcctccagatttctcgccgggtaaagactggttgtattca
aacacaggatacgtaatactaggaatgcttattgaaaaaataactggaaatagttatgcg
gaagaaatcgaaaagcgaattattgaacctttagacctatcaaatacgtttttaccagga
aattcacccgtcatcccaggaaagaatcatgctcgtggatatgtgaaaatggaaggaaca
ggcgagttgaaagacattacgtattataatccgagtttagctaatgcagctggagatatg
atttctaatgcggatgatttaaataagttcttttcatctttactcggtggtaagttactg
aaggaacgcgagctaaaagaaatgcttactacagttcctatagaaggaaaaggggttggt
gacgcatacggtcttggaatctatgagactaaacttccaaacggtgtttcagtttggggg
catggaggaggaattcctggatttacaacttttgctgggggagtaattggaggcaaacat
acattggctatcagtctcaactctataggtggggtcgatattgttccgcagtttaataaa
atgatgcaaattgaatttaataaatag

DBGET integrated database retrieval system