KEGG   Bacillus cereus ATCC 14579: BC3323Help
Entry
BC3323            CDS       T00127                                 

Definition
(RefSeq) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00010  Glycolysis / Gluconeogenesis
bce00230  Purine metabolism
bce00620  Pyruvate metabolism
bce01100  Metabolic pathways
bce01110  Biosynthesis of secondary metabolites
bce01120  Microbial metabolism in diverse environments
bce01130  Biosynthesis of antibiotics
bce01200  Carbon metabolism
bce01230  Biosynthesis of amino acids
Module
bce_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
bce_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC3323
   00620 Pyruvate metabolism
    BC3323
  Nucleotide metabolism
   00230 Purine metabolism
    BC3323
Enzymes [BR:bce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     BC3323
Membrane trafficking [BR:bce04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BC3323
Exosome [BR:bce04147]
 Exosomal proteins
  Proteins found in most exosomes
   BC3323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK HpcH_HpaI IMPDH ArgoMid DUF4456
Motif
Other DBs
NCBI-GeneID: 1205670
NCBI-ProteinID: NP_833062
UniProt: Q81B65
LinkDB All DBs
Position
complement(3287414..3288484)
Genome map
AA seq 356 aa AA seqDB search
MVTKMTIDRICTIGPASNNKETLAQLIKNGMKIVRLNLSHGTHESHKDIIRLVKSLDDSI
KFLGDVQGPKIRLGEVKGEQITLQAGDSFILHTQPVTGSNTEASVDYEGIANDVKVGSRI
LINDGEVELIVEKISTDKIETKVKTGGNISSHKGVNLPDAAVRLPAITEKDKKDIQFLLE
ENVDFIACSFVRKPSHIKEIRDFIQQYKETSPNVIAKIETMEAIENFQDICKEADGIMIA
RGDLGVELPYQCIPLLQKMMIQECNRTNTYVITATQMLQSMVDHSIPTRAEVTDVFQAVL
DGTNAVMLSAESASGEHPIESVRTLRLVSEFAEHVKKDGPFAMKDVLQLLRESLDE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggtgacaaaaatgacaatcgatcgaatttgtacaattggacccgcaagtaataataaa
gaaacgttagcacagttaataaagaatggtatgaaaattgttcgactgaatttatcgcat
ggcacgcatgaaagtcataaagacatcattcgtttagtgaaatcattagatgactctatt
aaatttttgggtgatgtacaaggtcctaaaataagattaggtgaagtgaagggagagcaa
attacacttcaggcaggagattcttttattttacatacacaaccagttacagggagtaat
acagaagcaagcgttgattatgaaggaattgcgaatgatgtgaaagtaggcagtagaatt
ttaattaatgatggagaagttgaattaattgttgaaaagataagtacggacaaaatagaa
acgaaggtaaaaacaggtggcaatatctcatctcataaaggagttaatttaccagatgcg
gctgttcgtttaccagctattacagagaaagataaaaaagatattcagtttcttttagaa
gagaatgttgattttatcgcgtgttctttcgtaagaaaacctagtcatataaaagaaata
cgagattttatacaacagtataaagaaacgtcacctaatgtaattgcaaaaatagaaacg
atggaagcaatcgagaattttcaagatatatgtaaagaagcagatggaattatgattgca
aggggcgatttaggagtagagttaccgtatcaatgcattccgcttttacagaaaatgatg
attcaggaatgtaatcgaacgaatacatatgtcattacagcaacacaaatgcttcaatct
atggtagatcattctattccaacaagggcagaggtgactgatgtgtttcaagctgtactg
gacgggacgaatgcagttatgctttcagctgaaagtgcatcaggagagcatccaatcgaa
agtgtgagaacattacgtctcgtttcagaatttgcggaacatgttaaaaaagatggacct
tttgcgatgaaagatgtactgcaattactgcgtgagtctctggatgagtaa

DBGET integrated database retrieval system