KEGG   Bacillus cereus ATCC 14579: BC3860Help
Entry
BC3860            CDS       T00127                                 

Definition
(RefSeq) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bce  Bacillus cereus ATCC 14579
Brite
KEGG Orthology (KO) [BR:bce00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bce01001]
    BC3860
Enzymes [BR:bce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BC3860
Protein kinases [BR:bce01001]
 Serine/threonine kinases: Other
  Bacterial family
   BC3860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH RIO1 Kinase-like Haspin_kinase Kdo Fructosamin_kin
Motif
Other DBs
NCBI-GeneID: 1206205
NCBI-ProteinID: NP_833581
UniProt: Q819U5
LinkDB All DBs
Position
complement(3838191..3840164)
Genome map
AA seq 657 aa AA seqDB search
MLIGKRLNDRYKLLKMIGGGGMANVYLAHDDILGRDVAVKILRLDYSNNEEFIKRFHREA
QSVTTLSHPNIVNMYDVGEEDGIYYLVMEYVPGQTLKQYIIERGMLPIGEALDIMEQLTS
AMAHAHHFEIVHRDIKPHNILIRADGIIKVTDFGIATATSATTITHTNSVLGSVHYLSPE
QARGGIANKQSDIYSLGIVMFELLTGRQPFSGESAVAIALKHLQSEIPSPKRWNENIPQS
VENIILKATAKDPFHRYQSANAMKRDIETALYPERINEQPFYIPEDMEATKAIPIIQQEQ
LFENVSDETIVLKGSKVEEPIRAEAAELDKKKKRSNKWLKVLISTFLFLAIGITLALTVI
PGLFIPKDVKVPDVAGMKYTTAVNTLVEKGFEVTEPNIVYTDDVEVGDVIKTDPVAGRVV
KENAKITIYQSGGKKKSKMANFTGQNFESVKAELEEKYKQVTVNYIENDKPKGEIVEQIP
TPDQMVIEAEQELKIWVSKGPYQIRPGDFSGWTENSVTGYLNERKLTSDIKREYSDTVEK
GLVISQFPKPGTPLKEGDKVTIIISDGQKPKVTKTVKLDNISIPYEPAVTGEKKPQTIEI
YKEDMQQKMDRPVETRTITESATISLEFVIQEGSKGHYKIVRDGVTIIDKEVPYPTQ
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
gtgctgattggaaaacgcttaaatgaccgttataagctgctgaaaatgattggtggtggc
ggaatggccaatgtatatttagctcatgatgatatacttggccgagatgtagcggtaaaa
atattaagactcgactactcaaataacgaagagtttattaaacgtttccatcgagaagcg
cagtctgttacaacgttgtcgcatccaaatattgtgaatatgtatgatgtcggagaagaa
gatggtatatactatcttgtcatggaatatgtaccaggacaaacattgaagcaatacata
attgagcgagggatgttacctataggagaagctcttgatattatggagcagttaacatcc
gctatggcacacgcccatcattttgaaattgtgcatcgtgatataaagccgcacaatatt
ttaattcgagctgatggaataataaaagtaacagattttggaattgcgacagctacaagt
gcaacaacaattacacatacaaattcagtgctcggttcagtccattatttatcaccagaa
caggcacgtggcggaatagcaaataaacaatcagatatctattctcttgggatagttatg
tttgaattgttaacaggaagacaaccgttttctggcgaatctgctgttgctatagcttta
aaacatttacaaagtgaaatcccatcaccaaaaagatggaatgaaaatattccgcaaagt
gttgaaaatattatattaaaagcaactgcaaaagatccgttccatcgatatcaatctgcc
aatgcgatgaagcgagatattgaaactgcgctatatccagagaggataaatgagcaaccg
ttttacataccagaagatatggaagcgacgaaagcgattccgattattcaacaagaacaa
ttatttgaaaatgtaagtgatgaaacgattgttttaaaagggagtaaggtggaagaaccg
ataagagcagaagcagctgagttagataagaagaaaaaacggagtaacaagtggcttaaa
gttttaatttcaacatttttatttttagcaataggaataacattagcgcttacggttatt
ccaggattatttattccgaaagatgtgaaagttcctgatgtggctggtatgaaatacacg
acagctgtaaatacattagtagaaaagggctttgaggtgacggagcctaatattgtatat
acagatgatgttgaagttggggatgtaataaaaacggaccctgtagcaggaagagtcgta
aaagaaaacgctaaaattactatctatcaatcaggtgggaaaaagaaaagtaagatggcg
aatttcacagggcaaaactttgagagtgtaaaagctgagttagaagaaaaatataaacaa
gttacagtaaattatattgaaaatgataagccgaaaggtgaaattgtagagcaaattccg
acgcctgatcaaatggttatagaagcggagcaagaactgaaaatctgggtaagtaaaggt
ccttatcaaattagaccaggtgacttttcggggtggactgaaaatagtgtaactggttat
ttgaatgagagaaaactaacgtcagatataaaacgagagtattcagatacagtcgaaaaa
ggacttgtaatttcgcaatttccaaaaccaggtacaccattaaaagagggagataaagta
actattattatctctgatggtcaaaagcctaaagtgactaaaacggtaaaattggacaat
atctctatcccatatgagcctgctgtaacaggtgaaaaaaagccgcaaacaatagaaatt
tataaagaagacatgcagcaaaaaatggatagaccggttgaaacgagaacaattactgaa
tcagcgactatttctttagaatttgtaattcaagaaggttcaaagggacactataaaatt
gtacgagatggagtaacgattattgataaagaagtaccatatccaactcaataa

DBGET integrated database retrieval system