KEGG   Bacillus cereus ATCC 14579: BC4272Help
Entry
BC4272            CDS       T00127                                 

Definition
(RefSeq) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bce  Bacillus cereus ATCC 14579
Brite
Enzymes [BR:bce01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BC4272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 1206617
NCBI-ProteinID: NP_833986
UniProt: Q818I1
LinkDB All DBs
Position
complement(4219337..4219993)
Genome map
AA seq 218 aa AA seqDB search
MSLKWQYINWEEYNNGKTRIYQIYPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALE
GHAELADKSVEELVANLNEVPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQPVGELATA
IEAKFGSFDAFKEEFAKAGATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLD
VWEHAYYLNYQNRRPDYIGAFWNVVDWNAAEKRYQEAK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttaagtggcaatacataaactgggaggaatataacaatggcaaaacacgaatt
taccaaatttacccttatgcgtatgatgctttagagcctcactttgacaaagaaacaatg
aacatccatcatacaaaacatcacaacacgtacattacaaacttaaacgctgctttagaa
ggtcatgcagaattagctgacaaaagcgtagaagaattagttgcaaacttaaacgaagta
ccagaagcaatccgtacagcagtacgtaacaatggtggcggacatgctaaccatacattc
ttctggacaatcctatctccaaacggcggaggacaacctgtaggtgaacttgcaactgca
attgaagcaaaattcggtagcttcgatgcattcaaagaagaattcgcaaaagctggcgca
actcgctttggttctggttgggcttggttagtagtaaacaatggtgagttagaagtaaca
agcactccaaaccaagattctcctttaactgaaggtaaaactccagttatcggtttagat
gtttgggagcatgcttactacttaaactaccaaaaccgtcgtccagactacatcggcgca
ttctggaacgttgtagattggaacgctgctgaaaaacgttaccaagaagcaaaataa

DBGET integrated database retrieval system