KEGG   Bacillus cereus ATCC 14579: BC4510Help
Entry
BC4510            CDS       T00127                                 

Definition
(RefSeq) sodium export ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
bce  Bacillus cereus ATCC 14579
Brite
KEGG Orthology (KO) [BR:bce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bce02000]
    BC4510
Transporters [BR:bce02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    BC4510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran DUF4162 AAA_21 SMC_N AAA_29 DUF494 AAA_23 SbcCD_C AAA_16 AAA_22 MukB
Motif
Other DBs
NCBI-GeneID: 1206855
NCBI-ProteinID: NP_834219
UniProt: Q817M8
LinkDB All DBs
Position
complement(4454948..4455832)
Genome map
AA seq 294 aa AA seqDB search
MSLQIQNLTKQFGESKAVNGLQISLPKGEVLGLLGRNGAGKTTTIKMLLGLLTPNEGSIT
WDGKAFGNSGVTIGYLPEERGLYTKSRVIDQLRYFGRLEGMSKKEVDHAIDHWLERLAIP
EYKFKTAGELSKGNQQKIQLIAALLHNPELLILDEPFSGLDPVNAGMLAIIIEEQVQSGK
TIILSSHRMEQVEAFCQHVCILKKGEAVVKGQLSDIKKEYGFRNLTIEDTVENEKGLEAI
HVSYEKQQGLLYVKVQDDAEALKILQQLQEQGVSLRQFKMLEPTLNEIFVERAK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
ttgagtttacaaattcaaaacttaacgaaacaatttggggaatcaaaagcagttaacggt
ttgcaaatttcgttaccaaaaggtgaagtactagggttacttggacgaaatggtgcaggg
aaaacaacaacaatcaaaatgcttctcggattattaacgcctaatgaaggttcgattaca
tgggatggaaaagcatttggaaatagtggtgtaacaattgggtatttaccagaagaaaga
ggtttatatacaaaaagtagagtaatagatcagctgcgatattttggtagattagaagga
atgtcgaagaaagaagtggatcacgctattgatcactggttagagcgtttagcgatacca
gaatataaatttaaaacggctggagagctttcaaaagggaatcagcaaaaaatccaatta
attgctgctcttcttcataatccggaacttctcattctagatgaaccattcagcggcctt
gatccagttaatgctgggatgttagctattattattgaagaacaagtacagagcggaaag
acgattattttatcaagtcatcgtatggaacaagtagaggctttttgccaacatgtatgt
attttgaaaaaaggtgaagcagtcgtaaaaggacagctaagtgatattaagaaagaatac
ggtttccgtaatttaacgattgaagatacagtagagaatgaaaagggattagaagctata
catgtatcgtatgaaaaacaacaaggccttctttatgtgaaagtacaagacgatgcggaa
gctctcaagattttgcaacagttgcaagagcaaggtgttagcttacgacaattcaaaatg
ttagagccgacgttaaacgaaatctttgtagagagggcgaaataa

DBGET integrated database retrieval system