KEGG   Burkholderia cepacia DDS 7H-2: DM42_188Help
Entry
DM42_188          CDS       T03302                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bced  Burkholderia cepacia DDS 7H-2
Pathway
bced00020  Citrate cycle (TCA cycle)
bced00310  Lysine degradation
bced00380  Tryptophan metabolism
bced01100  Metabolic pathways
bced01110  Biosynthesis of secondary metabolites
bced01120  Microbial metabolism in diverse environments
bced01130  Biosynthesis of antibiotics
bced01200  Carbon metabolism
Module
bced_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bced_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bced00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DM42_188 (sucB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    DM42_188 (sucB)
   00380 Tryptophan metabolism
    DM42_188 (sucB)
Enzymes [BR:bced01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     DM42_188 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AIO49180
UniProt: A0A095DNG2
LinkDB All DBs
Position
1:complement(210734..212011)
Genome map
AA seq 425 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV
LQNDGDTVVADQIIATIDTEAKAGAAEAAAGAAEVKPAAAPAAAAPAAQPAAATASSSAA
ASPAAAKLLAEKGLSTGDVAGSGRDGRVTKGDALAAGSAPKAAPAAAPAKTAAAKPSLPE
VKVPASAATWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMELRNKY
KDKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLV
VPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINP
PQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPAR
LLLDL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagctgtcggagtcggtgtcggaagccaccatg
ctgcagtggaagaagaagccgggcgaagcagtcgcgcaggatgaaatcctgatcgaactc
gagaccgacaaggtcgtcctcgaagtgccggcaccggcagcgggcgtgctcgcgcaagtg
ctgcagaacgacggcgacacggtcgtggccgaccagatcatcgcgacgatcgacaccgaa
gcgaaggcaggtgctgccgaagcagcggcaggcgccgccgaagtcaagccggccgccgcg
ccggctgccgccgcaccggccgctcagccggcagccgcaaccgcgtcgagctcggccgcc
gcatcgccggccgcagcgaagctgctggccgagaagggcctgtcgacgggcgacgtcgca
ggttcgggccgcgacggccgcgtcacgaagggcgacgcgctggctgcaggcagcgcaccg
aaggctgctccggccgccgcaccggcgaagaccgccgctgcgaagccgtcgctgccggaa
gtgaaggtgccggcgtcggccgcgacgtggctgaacgatcgtccggaacagcgcgtgccg
atgtcgcgtctgcgtgcgcgtatcgccgagcgtctgctcgaatcgcagcagaccaacgcg
atcctgacgacgttcaacgaagtgaacatggctccggtcatggaactgcgcaacaagtac
aaggacaagttcgagaaggaacatggcgtgaagctcggcttcatgtcgttcttcgtgaag
gccgccgtccatgcgctgaagaaattcccgctcgtgaacgcgtcgatcgacggtaacgac
atcgtctatcacggctacttcgacatcggtatcgcggtcggttcgccgcgcggcctggtc
gtgccgatcctgcgcaacgcggatcaactgagcctcgccgagatcgagaagaagatcgcc
gaattcggccagaaggcgaaggacggcaagctgtcgatcgaggaaatgacgggcggtacg
ttctcgatctcgaacggcggcgtgttcggctcgatgctgtcgaccccgatcatcaacccg
ccgcagtcggccatcctcggcgtgcacgcgacgaaggagcgcccggtcgtcgagaacggc
cagatcgtgatccgcccgatcaactacctcgcgctgtcgtacgaccaccgcatcatcgac
ggccgcgaagccgtgctgtcgctcgtcgcgatgaaggatgcgctggaagatccggcacgc
ctgctgctcgacctgtaa

DBGET integrated database retrieval system