KEGG   Burkholderia cepacia DDS 7H-2: DM42_2465Help
Entry
DM42_2465         CDS       T03302                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
bced  Burkholderia cepacia DDS 7H-2
Pathway
bced00010  Glycolysis / Gluconeogenesis
bced00071  Fatty acid degradation
bced00350  Tyrosine metabolism
bced00625  Chloroalkane and chloroalkene degradation
bced00626  Naphthalene degradation
bced00680  Methane metabolism
bced01100  Metabolic pathways
bced01110  Biosynthesis of secondary metabolites
bced01120  Microbial metabolism in diverse environments
bced01200  Carbon metabolism
bced01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bced00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DM42_2465
  09102 Energy metabolism
   00680 Methane metabolism
    DM42_2465
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DM42_2465
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    DM42_2465
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DM42_2465
   00626 Naphthalene degradation
    DM42_2465
Enzymes [BR:bced01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DM42_2465
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     DM42_2465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C Met_10 UDPG_MGDP_dh_N TrkA_N RTC4 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AIO48844
UniProt: A0A095DX32
LinkDB All DBs
Position
1:2664652..2665758
Genome map
AA seq 368 aa AA seqDB search
MKTKAAIAWKAGAPLTIEEVDLEGPRAGEVLIEVKATGICHTDYYTLSGADPEGIFPAIL
GHEGAGVVVDVGPGVGTVRKGDHVIPLYTPECRECKFCLSRKTNLCQKIRATQGKGLMPD
ATSRFSLDGKPLFHYMGTSTFSNYIVVPEIAVAKVREDAPFDKICYIGCGVTTGVGAVVY
SAKVEAGANVVVFGLGGIGLNVIQGAKMVGADKIIGVDINPKRVELAKKFGMTHFINPNE
VENVVDHIVQLTDGGADYSFECVGNVKLMRQALECTHKGWGQSFIIGVAAAGEEISTRPF
QLVTGREWKGSAFGGARGRTDVPKIVDWYMEGKINIDDLITHTLPLERINEGFDLMKAGE
SIRSVVLY
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgaaagccgcgattgcatggaaggccggtgcgccgctcacgatcgaggaagtc
gatctcgaagggccgcgcgccggcgaagtgctgatcgaagtgaaggcgacgggcatctgc
cacaccgactactacacgctgtcgggcgccgatccggaagggatcttcccggcgatcctc
ggccatgaaggcgcgggcgtggtggtcgacgtcggccccggcgtcggcaccgtgaggaag
ggcgaccacgtgattccgctctacacgcccgaatgccgcgagtgcaagttctgcctgtcg
cgcaagaccaacctgtgccagaagatccgcgcgacgcagggcaagggcctgatgccggac
gcgacgtcgcgcttctcgctcgacggcaagccgctgttccactacatgggcacgtcgacg
ttctcgaactacatcgtcgtgccggagatcgcggtcgcgaaggtgcgcgaggacgcgccg
ttcgacaagatctgctacatcggctgcggcgtgacgacgggcgtcggcgcggtcgtgtac
tcggcgaaggtcgaggccggtgcgaacgtggtcgtgttcggcctcggcgggatcggcctg
aacgtgatccagggcgcgaagatggtcggcgcggacaagatcatcggcgtcgacatcaac
ccgaagcgcgtcgagctcgcgaagaagttcgggatgacgcacttcatcaacccgaacgag
gtcgagaacgtcgtcgaccacatcgtgcagctgaccgacggcggcgccgactactcgttc
gaatgcgtcggcaacgtgaagctgatgcgccaggcgctcgagtgcacgcacaagggctgg
ggccagtcgttcatcatcggcgtggcggcagcgggcgaggaaatcagcacgcgcccgttc
cagctggtgacgggccgcgaatggaagggctcggcgttcggcggcgcacgcgggcgcacc
gacgtgccgaagatcgtcgactggtacatggaaggcaagatcaacatcgacgacctgatc
acgcacacgctgccgctcgagcggatcaacgaaggcttcgacctgatgaaggccggcgag
tcgatccgctcggtcgtgctgtactga

DBGET integrated database retrieval system