KEGG   Burkholderia cepacia DDS 7H-2: DM42_2543Help
Entry
DM42_2543         CDS       T03302                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bced  Burkholderia cepacia DDS 7H-2
Pathway
bced00020  Citrate cycle (TCA cycle)
bced00480  Glutathione metabolism
bced01100  Metabolic pathways
bced01110  Biosynthesis of secondary metabolites
bced01120  Microbial metabolism in diverse environments
bced01130  Biosynthesis of antibiotics
bced01200  Carbon metabolism
bced01210  2-Oxocarboxylic acid metabolism
bced01230  Biosynthesis of amino acids
Module
bced_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bced_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bced00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DM42_2543 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DM42_2543 (icd)
Enzymes [BR:bced01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     DM42_2543 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AIO49307
UniProt: A0A081V203
LinkDB All DBs
Position
1:2748163..2749419
Genome map
AA seq 418 aa AA seqDB search
MPYQHIKVPEGGDKITVNKDFSLNVSDQPIIPYIEGDGTGFDITPVMIKVVDAAVAHAYK
GKRKIHWMEIFAGEKATKVYGPDVWLPDETLQVLKEYVVSIKGPLTTPVGGGIRSLNVAL
RQELDLYVCLRPVQYFKGVPSPVREPQKIDMVIFRENSEDIYAGIEWAAGSEQAKKVIKF
LQDEMGVKKIRFPETSGIGVKPVSTEGTERLVRKAIQYAIDNDRKSVTLVHKGNIMKFTE
GLFRDAGYALAQKEFGGELIDGGPWMRVKNPKTGNEIVIKDSIADAFLQQILLRPAEYDV
IATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWTEAADTIIAAMEKSILQKRVTYDFARLMEGATQVSCSGFGEVLIENM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcagcacatcaaggttccggagggcggtgacaagatcaccgtcaacaaggac
ttctcgctcaacgtttccgatcagccgatcattccctatatcgaaggcgacggtacgggc
ttcgatatcacgccggtcatgatcaaggtcgtcgacgcggcggtcgcgcacgcgtacaag
ggcaagcgcaagatccactggatggagatcttcgcgggcgagaaggcgaccaaggtgtac
ggtccggacgtgtggctgccggacgaaacgctgcaggtcctgaaggaatacgtggtgtcg
atcaaggggccgctcacgaccccggtcggcggcggcatccgttcgctgaacgtcgcgctg
cgccaagagctcgatctctacgtgtgcctgcgccccgtccagtacttcaagggcgtgccg
tcgccggtgcgcgaaccgcagaagatcgacatggtgatcttccgcgagaactcggaagac
atctacgcgggcatcgaatgggccgcgggctccgagcaggcgaagaaggtgatcaagttc
ctgcaggacgagatgggcgtgaagaagatccgcttcccggaaacctccgggatcggcgtg
aagcccgtgtcgaccgaaggcaccgagcggctcgtgcgcaaggcgatccagtacgcgatc
gacaacgatcgcaagtcggtcacgctggtgcacaagggcaacatcatgaagttcacggaa
ggcctgttccgtgacgccggctacgcgctcgcgcagaaggaattcggcggcgagctgatc
gatggcggcccgtggatgcgcgtgaagaacccgaagacgggtaacgagatcgtgatcaag
gattcgatcgccgacgcgttcctgcagcagatcctgctgcgcccggccgaatacgacgtg
atcgcgacgctgaacctgaacggtgactacatctccgacgcgctggccgcgcaggtcggc
ggcatcgggatcgcgccgggcgcgaacctgtcggattcggtcgcgatgttcgaggcgacg
cacggcacggcgccgaagtacgcgggcaaggattacgtgaacccgggttccgagatcctg
tcggcggaaatgatgctgcgccacctcggctggacggaagcagccgacacgatcatcgcc
gcgatggagaagtcgatcctgcagaagcgcgtcacgtacgacttcgcgcgcctgatggaa
ggcgcgacgcaggtgtcgtgctccggcttcggcgaagtgctgatcgagaacatgtaa

DBGET integrated database retrieval system