KEGG   Burkholderia cepacia DDS 7H-2: DM42_2647Help
Entry
DM42_2647         CDS       T03302                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bced  Burkholderia cepacia DDS 7H-2
Pathway
bced00620  Pyruvate metabolism
bced00680  Methane metabolism
bced00710  Carbon fixation in photosynthetic organisms
bced01100  Metabolic pathways
bced01120  Microbial metabolism in diverse environments
bced01200  Carbon metabolism
Module
bced_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bced00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DM42_2647
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    DM42_2647
   00680 Methane metabolism
    DM42_2647
Enzymes [BR:bced01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DM42_2647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AIO47024
UniProt: A0A095G3D9
LinkDB All DBs
Position
1:complement(2857733..2860747)
Genome map
AA seq 1004 aa AA seqDB search
MKSSGSARTVRRNAALPSPDAPTGTLATAANGRAKTATKPKDSIRQTKPATKAAGAPARK
AVAPKAGTRTRDDKDGPLFEDIRFLGRLLGDVVREQEGDTVFDVVETIRQTAVKFRREDD
SEAAQTLEKKLRKLTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSAPQPGTV
AYALDQLKTTGNASKRLLQRFFDDALIVPVLTAHPTEVQRKSILDAQHDIARLLAERDQE
LTARERQYNEAMLRARVTALWQTRMLRDSRLTVGDEIENALSYYRATFLDELPALYGDIE
AALAEHGLSARVPAFFQMGSWIGGDRDGNPNVTAATLDEAINRQAAVILEHYLEQVHKLG
AELSVSNLLVGANDAVKALAAASPDQSPHRVDEPYRRALIGIYTRLAASARVRLGEGTVP
VRSAGRGAPPVRAIPYEDSEAFVADLKVLTASLDEHHGASLAAPRLAPLVRAAEVFGFHL
ASIDLRQSSDIHEAVVAELFARAGVEADYAALAEEDKLRVLLAALADPRPLRSPYLEYSA
LAQSELGVFEKAREVRTQFGARAVRNYIISHTETVSDLVEVLLLQKETGLLEGTLGVPGR
DAKNSLMVIPLFETIPDLRDASRIMRDYFALPGIDALIAHQGAEQEVMLGYSDSNKDGGF
LTSNWELYRAELALVDLFRERKITLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRL
TEQGEVIASKFSNPSIGRRNLETVVAATLEASLLPQSNAPAQLPAFEAAMQTLSDSAMAA
YRALVYETPGFTDYFFSSTPITEIAELNIGSRPASRKLQDPKQRKIEDLRAIPWGFSWGQ
CRLLLTGWYGFGSAVSAYLDGAPDAAERTKRVTLLKRMNKTWPFFSNLLSNMDMVLAKTD
LAVASRYAQLVSDRKLRKHVFERIVAEWERTSQALAEITGHEGRLATNPLLARSIKNRFP
YLDPLNHLQVELIKRHRAGDTNARLRRGIHLTINGIAAGLRNTG
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcttccggatcggcgcgtacggtgcgccgcaatgctgccttgccctcccccgac
gccccgacgggcaccctcgccaccgccgcgaacggccgtgcgaaaacggcaacgaaaccg
aaagactcgatacgtcagacaaaacccgcgacgaaagccgccggcgcccccgcccgcaag
gccgtcgcaccgaaggccggcacccgcacgcgcgacgacaaggacggcccgctgttcgag
gacatccgcttcctcggccgcctgctcggcgacgtcgtgcgcgaacaggaaggcgatacg
gtgttcgacgtggtcgagacgatccgccagaccgcggtcaagttccgccgcgaggacgac
agcgaagccgcgcagacgctcgagaagaagctgcgcaagctgacgccggagcagacggtg
agcgtcgtgcgcgcgttcagctatttctcgcatctcgcgaacatcgcggaagaccgccac
cacaaccgccgccgccgcatccacgcgctggccgggtccgcgccgcagcccggcacggtc
gcgtacgcgctcgaccagctgaaaaccaccggcaacgcgtcgaagcgcctgctgcagcgc
ttcttcgacgatgcgctgatcgtgccggtgctgaccgcgcacccgaccgaagtgcagcgc
aagagcatcctcgatgcgcagcacgacatcgcgcgcctgctcgcggagcgcgaccaggag
ctgaccgcgcgcgaacgccagtacaacgaagcgatgctgcgcgcgcgcgtgaccgcgctg
tggcagacgcggatgctgcgcgactcgcgcctgacggtcggcgacgagatcgagaacgcg
ctgtcgtactaccgcgcgacgttcctcgacgaactgcccgcgctgtacggcgacatcgag
gccgcgctcgccgagcacggcctgtcggcccgcgtgcccgcgttcttccagatgggcagc
tggatcggcggcgatcgcgacggcaacccgaacgtgaccgccgcgacgctcgacgaggcg
atcaatcgccaggccgcggtgatcctcgaacattatctggaacaggtgcacaagctgggc
gccgagctgtcggtgtcgaacctgctggtcggcgcgaacgacgcggtgaaggcgctcgcg
gccgcatcgcccgaccagtcgccgcaccgcgtcgacgaaccgtatcgccgcgcgctgatc
ggcatctacacgcggctcgccgcgagcgcgcgcgtacgtctcggcgaaggcacggtgccg
gtgcgcagcgcgggccgcggcgcgccgcccgtgcgtgcgattccatacgaggactccgaa
gcgttcgtcgccgatctcaaggtgctgaccgcgtcgctcgacgagcaccacggcgcgtcg
ctcgccgcgccgcgcctcgcgccgctcgtgcgcgcggccgaagtgttcggcttccatctc
gcgagcatcgacctgcgccagagttccgacatccacgaggcggtggtcgccgaactgttc
gcgcgcgccggcgtcgaggccgactatgcggcgctcgcggaggaagacaagctgcgcgtg
ctgctcgcagcgctcgccgatccgcgcccgctgcgctcgccgtacctcgaatactcggcg
ctcgcgcagagcgagctgggcgtgttcgagaaggcgcgcgaggtccgcacgcagttcggt
gcgcgcgcggtgcgcaactacatcatttcgcatacggaaaccgtcagcgacctcgtcgag
gtgctactgctgcagaaggagacgggcctgctcgaaggcacgctcggcgtgccgggccgc
gacgcgaagaacagcctgatggtgatcccgctgttcgagacgatccccgacctgcgcgac
gcgtcgcgcatcatgcgcgactacttcgcgctgccgggcatcgacgcgttgatcgcgcat
cagggcgccgaacaggaagtgatgctcggctactcggacagcaacaaggacggcggcttc
ctcacgtcgaactgggagctgtatcgcgcggaactcgcgctcgtcgacctgttccgcgag
cgcaagatcacgctgcggctgttccatggccgcggcggcacggtcggccgcgggggcggc
ccgacctaccaggcgatcctgtcgcagccgccgggcaccgtgaacggccagatccgcctg
accgaacagggcgaggtgatcgcgagcaagttctcgaacccgtcgatcggccggcgcaac
ctcgagacggtcgtcgccgcgacgctcgaggcgtcgctgctgccgcagtcgaacgcaccg
gcgcagttgcccgcgttcgaggccgcgatgcagacgctgtccgactcggcgatggccgcg
taccgcgcgctcgtctatgaaaccccgggcttcaccgactacttcttctcgtcgacgccg
atcaccgagatcgccgagctgaacatcggcagccggccggcgtcgcgcaagctgcaggac
ccgaagcagcgcaagatcgaggatctgcgcgcgattccgtggggcttctcgtggggccag
tgccggctgctgctgaccggctggtacggcttcggcagcgcggtgagcgcgtatctcgac
ggcgcgccggacgccgccgaacgcacgaagcgcgtcacgctgctgaagaggatgaacaag
acctggccgttcttctcgaacctgctgtcgaacatggacatggtgctcgcgaagaccgat
ctcgcggtcgcgtcgcgttatgcgcaactcgtgtccgatcgcaagctgcgcaagcacgtg
ttcgagcggatcgtcgcggaatgggaacgcacgtcgcaggcgctcgcggaaatcaccggg
cacgaaggccgcctcgcgaccaacccgctgctcgcgcgctcgatcaagaaccgcttcccg
tatctagatccgctgaatcacctgcaggtcgagctgatcaagcgtcaccgcgcgggcgac
acgaacgcgcggctgcgccgcgggattcacctgacgatcaacgggatcgcggccggcctg
cgcaacaccggctga

DBGET integrated database retrieval system