KEGG   Burkholderia cepacia DDS 7H-2: DM42_2771Help
Entry
DM42_2771         CDS       T03302                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K00344  NADPH:quinone reductase [EC:1.6.5.5]
Organism
bced  Burkholderia cepacia DDS 7H-2
Brite
KEGG Orthology (KO) [BR:bced00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DM42_2771
Enzymes [BR:bced01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.5  NADPH:quinone reductase
     DM42_2771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 ADH_N ADH_N_2
Motif
Other DBs
NCBI-ProteinID: AIO46893
UniProt: A0A095DQR1
LinkDB All DBs
Position
1:2990229..2991203
Genome map
AA seq 324 aa AA seqDB search
MPKAIRYDQPGGPDVMKWVDVEVGAPKAGEVRIRQHAVGLNYIDVYFRTGLYPQPLPGGL
GMEAAGEVTAVGDGVTAFKAGDRVAYVGQPPGAYAQERVMPAERIVKLPDGIGYDDAASV
MLQGLTAHYLLRRTYPVKAGDTILIHAAAGGVGLLVCQWAKALGATVIGTVGSDEKAELA
KAHGCDHPIVYTRENFTQRVKAITNGAGVPVVYDSIGKDTYIGSLDCLAPLGYFVSFGNA
SGPLPPIDSKEFSSRGSLFFTRPTLFSYIAKRADLEAAAAELFDVILSGKVKTSINQRYP
LAEVGRAHADLEARKTTGSTILVP
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaagcaatccgatacgaccagccgggcggcccggacgtgatgaagtgggtcgat
gtcgaggtcggtgcgccgaaggcgggcgaagtccgcatccggcaacacgccgttgggctc
aactacatcgacgtgtatttccgcacgggcctgtatccgcagccgctgcccggcggcctc
gggatggaggcggcgggcgaggtgacggccgtcggcgacggcgtgaccgcgttcaaggcc
ggcgaccgtgtcgcctatgtcggccagccgcccggcgcgtatgcgcaggagcgcgtgatg
ccggccgagcgcatcgtgaagctgccggacggcatcggctacgacgacgcggcgtcggtg
atgctgcagggcctgaccgcgcattacctgctgcgccgcacgtacccggtgaaggccggc
gacacgatcctgatccatgcggcggccggcggcgtcggcttgctcgtatgccagtgggcg
aaggcgctcggcgcgaccgtgatcggcacggtcggctccgacgaaaaggccgaactcgcg
aaggcgcacggctgcgaccacccgatcgtctacacgcgcgagaatttcacgcagcgcgtg
aaggcaatcacgaacggcgcgggcgtgccggtcgtctacgattcgatcggcaaggacacc
tacatcggctcgctcgactgccttgcgccgctcggctacttcgtcagcttcggcaatgcg
tcgggcccgctgccgccgatcgactcgaaggaattctcgtcgcgcggctcgctgttcttc
acgcggccgacgctgttctcgtacatcgcgaagcgcgccgatctcgaggccgcggccgcc
gagctgttcgacgtgatcctgtcggggaaggtgaagaccagcatcaaccagcgctacccg
ctcgccgaagtcggccgcgcgcatgccgatctggaagcacgcaagaccaccggctcgacg
atcctcgttccctga

DBGET integrated database retrieval system