KEGG   Burkholderia cepacia DDS 7H-2: DM42_3430Help
Entry
DM42_3430         CDS       T03302                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
Organism
bced  Burkholderia cepacia DDS 7H-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF2007 DUF5061
Motif
Other DBs
NCBI-ProteinID: AIO47495
UniProt: A0A095DPY1
LinkDB All DBs
Position
1:3665894..3667330
Genome map
AA seq 478 aa AA seqDB search
MKIYDQFYIDGAWRKPAGTGTIDVIDSGTEAVIGRIPEGVASDAQDAIRAARAAFDAWAA
TPAATRAGYLRKIVEHLQARSEELAQSITGEVGMPIKLSRAIQVGGPIYNWKAYAKLAES
FEFEARVGNSLVVREPVGVVAAITPWNYPLNQITLKVAPALAAGCTVVLKPSEVAPLNAF
MLAEAIHEAGLPAGVFNLVCGYGPVVGEVLATDPDVDMVSFTGSTRAGKRVAELAAAGVK
RVALELGGKSASVILDDADFATAVKGTVNACYLNAGQTCSAHTRMLVPEARYDEAREIAK
AVAETYVAGDPRQEATRLGALASAVQQQRVQAYIQRGIDEGAELVTGGTGLPEGLAKGFF
VKPTVFGRVDPKSTIAQEEIFGPVLSIITYRDEDEAVRIANDSPYGLGGAVWAGSDERAM
RVARRIRTGQVDINGGTWNGAAPFGGFKQSGHGRENGVYGLEEYLEYKSMQLKPAKPA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatctacgaccagttctacatcgacggcgcatggcgcaaaccggccggcaccggc
acgatcgacgtgatcgactcgggcaccgaagccgtgatcggccggattcccgagggcgtc
gcgtccgacgcacaggacgcgatccgcgcggcgcgcgcggccttcgacgcgtgggcggcc
acgccggccgcgacgcgcgcgggctatctgcgcaagatcgtcgagcatctgcaggcgcgc
agcgaggaactcgcgcagtcgatcaccggcgaagtcggcatgccgatcaagctgtcgcgc
gcgatccaggtgggcggcccgatctacaactggaaggcgtacgcgaagctcgccgaatcg
ttcgaattcgaggcccgggtcggcaattcgctggtggtgcgcgagccggtcggcgtcgtc
gcggcgatcacgccgtggaactacccgctcaaccagatcacgctgaaggtcgcgccggcg
ctcgcggccggctgcacggtggtgctgaagccgtccgaagtcgcgccgctcaacgcgttc
atgctcgccgaagcgatccacgaggccgggctgccggccggcgtgttcaacctcgtgtgc
gggtatggcccggtcgtcggcgaggtgttggcgaccgacccggacgtcgacatggtgtcg
ttcaccggctcgacgcgcgcgggcaagcgcgtggccgaactggcggccgcgggcgtcaag
cgcgtcgcgctggagctcggcggcaagtcggcatcggtgatcctcgacgacgccgatttc
gcgacggcggtgaagggcaccgtcaacgcgtgctacctgaacgccggccagacctgctcc
gcgcatacgcggatgctggtgccggaagcccgctacgacgaagcgcgcgagatcgcgaag
gccgtggccgaaacgtacgtcgcgggcgacccgcggcaggaggcgacgcgcctcggcgcg
ctggcgtcggccgtgcagcagcagcgcgtgcaggcgtacatccagcgcgggatcgacgaa
ggcgcggaactcgtgacgggcggcaccgggttgccggaagggctcgcgaagggcttcttc
gtgaagccgaccgtgttcggccgcgtcgatccgaaatcgacgatcgcgcaggaagagatc
ttcgggccggtgctgtcgatcatcacgtatcgcgatgaagacgaagccgtgcggatcgcg
aacgattcgccgtacgggctcggtggcgcggtgtgggccggcagcgacgaacgcgcgatg
cgcgttgcgcgccgcatccgcaccgggcaggtcgacatcaacggcggcacgtggaacggc
gccgcgccgttcggcggcttcaagcagtccgggcacggccgcgagaacggcgtgtacggg
ctcgaagagtatctcgaatacaagtcgatgcagttgaagccggccaagccggcctga

DBGET integrated database retrieval system