KEGG   Burkholderia cepacia DDS 7H-2: DM42_3516Help
Entry
DM42_3516         CDS       T03302                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bced  Burkholderia cepacia DDS 7H-2
Pathway
bced00010  Glycolysis / Gluconeogenesis
bced00071  Fatty acid degradation
bced00350  Tyrosine metabolism
bced00625  Chloroalkane and chloroalkene degradation
bced00626  Naphthalene degradation
bced01100  Metabolic pathways
bced01110  Biosynthesis of secondary metabolites
bced01120  Microbial metabolism in diverse environments
bced01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bced00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DM42_3516
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DM42_3516
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    DM42_3516
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DM42_3516
   00626 Naphthalene degradation
    DM42_3516
Enzymes [BR:bced01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DM42_3516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 TrkA_N AlaDh_PNT_C 2-Hacid_dh_C Methyltransf_25 Fibrillin_U_N
Motif
Other DBs
NCBI-ProteinID: AIO44926
UniProt: A0A095GMS6
LinkDB All DBs
Position
2:4171..5199
Genome map
AA seq 342 aa AA seqDB search
MTQTMKAAVVHAFGAPLRIEEVPIPAPGPGQILVNIKASGVCHTDLHAADGDWPVKPSLP
FIPGHEGVGIVAAVGAGVTHVREGDRVGVPWLYTACGHCEYCCTGWETLCHGQQNTGYSV
NGSYAEYVLADPDYVGQLPAQVAFDEIAPILCAGVTVYKGIRVTDTRPGQWLAISGIGGL
GHVAVQYARAMGLHVAAIDISPDKLALARQLGAHLTIDASIDDPATVIQKEIGGAHGVLV
TAVSRSAFAQALGMVRRGGTVALNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESL
DFAADGLVRAHIHRDRLGNINDVFAKLREGKVDGRIVLTDMH
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaccatgaaagcggccgtggtacacgcgttcggcgcgccgttgcgcatcgag
gaagtgccgattccggcaccggggcccggccagattctcgtcaacatcaaggcgtcgggt
gtttgccataccgatctgcacgcggccgacggcgactggcccgtcaagccgtcgctgccg
ttcatcccgggccatgaaggcgtggggatcgtcgcggcggtcggcgcgggcgtcacgcac
gtgcgcgagggcgatcgcgtcggcgtgccgtggctctatacggcctgcggccattgcgag
tactgctgcacgggctgggaaacgctctgccacggtcagcagaacaccggctattcggtg
aacggcagctacgcggaatacgtgctggccgatcccgactacgtcggccagttgcccgcg
caggttgcgttcgacgagatcgcgccgatcctgtgcgcgggcgtcacggtctacaagggc
attcgcgtcaccgacacgcgcccgggccagtggctcgcgatttccggcatcggcggcctc
gggcacgtggccgtgcagtatgcgcgggcgatgggcctgcacgtcgcggccatcgacatt
tcccccgacaagctcgcgctggcgcggcaactgggcgcgcacctgacgatcgacgcgtcg
atcgacgaccccgcaacagtgatccagaaggaaatcggcggcgcgcacggcgtgctcgtc
acggccgtgtcgcgcagcgcgttcgcgcaggcgctcgggatggtccggcgcggcggcacg
gtggcgctcaacggtttgccgccgggcgatttcccgctgccgatcttctcgaccgtgctg
aacggcatcaccgtgcgcgggtcgatcgtcggcacgcggcgcgatctgcaggaatcgctc
gatttcgcggcggacggcctggtgcgcgcgcacatccaccgcgaccggctcggcaacatc
aacgacgtattcgcgaagctgcgggaagggaaggtcgacgggcgcatcgtgctgaccgac
atgcattga

DBGET integrated database retrieval system