KEGG   Burkholderia cepacia DDS 7H-2: DM42_3846Help
Entry
DM42_3846         CDS       T03302                                 

Gene name
aepX
Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bced  Burkholderia cepacia DDS 7H-2
Pathway
bced00440  Phosphonate and phosphinate metabolism
bced01100  Metabolic pathways
bced01120  Microbial metabolism in diverse environments
bced01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bced00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    DM42_3846 (aepX)
Enzymes [BR:bced01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     DM42_3846 (aepX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Motif
Other DBs
NCBI-ProteinID: AIO45290
UniProt: A0A095GG30
LinkDB All DBs
Position
2:392980..394668
Genome map
AA seq 562 aa AA seqDB search
MNAREPNFTESRSARLRRMLVSSDLEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIGGERQPLAEIDEFCGKIKAGKDSQTDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGKAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQATAREIHESETLINVEDRVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAAIVLAASRGKGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKTHGVNDITVVGGYR
ADAIDTSGIKLVVNERHAQTGELASLACAAERLTGDTVISYGDLLFRSYIVRDLAESEAE
FSVVVDSSLTESTNQSVRDFALCSAADDRGLFGQKTYLQRVSSDVAAGTPHGRWIGLLNV
RGAGVDRLKAMLATLQARPDFDTLDIPSLLNELVAAGEKIEVQYVHGHWRGVNDLEDFRR
AGDFAHGQTPLSEPGAGNGGAQ
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacgcgaacccaacttcaccgaatcgcgcagcgcgcgcctgcgccgcatgctc
gtcagcagcgacctcgaattcctgatggaagcgcacaacggcctgtccgcgcggatcgtc
cgcgaggccggcttcaaggggatctgggcgtcgggcctcgcgatctccgcgcaattcggc
gtgcgcgacaacaacgaagcgagctggacccaggtcgtcgacgtgctcgagttcatggcc
gacgcgagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccgcctcgtgaagaagctcgaacagcgtggcatcgccggcgtctgcatcgaggac
aagcagttcccgaagacgaacagcttcatcggcggcgagcgccagccgctcgcggaaatc
gacgaattctgcggcaagatcaaggccggcaaggattcgcagaccgatcccgacttctcg
atcgtcgcgcgtgtcgaagcgctgatcgccggctgggggatggacgaggcgctgcgccgc
gcgaacgcgtacgcagaagccggcgccgatgcgatcctgatccacagcaagctgtcgcgc
cccgacgagatcctgcagttcgcgcgcgaatggagcggcaaggcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccaaccgacgtgttccggcaggccggcatcagcaccgtg
atctgggcgaaccacctgattcgcgcgtcggcctccgcaatgcaggcgaccgcgcgcgag
atccacgagagcgaaacgctgatcaacgtcgaagaccgcgtcgcatcggtcaacgagatc
ttccgcctgcaggacgccgacgaatactcggcggccgagcgcatctacctgtcgtcgtcc
tcgcgcgcgtcgaacgcggcgatcgtgctcgccgcgagccgcggcaagggcctggaagcc
gtgaccgaagacaagccgaaggtcatgctgccggtcgccggcaagccgctcttgcgctgg
ctcgtcgacggcttcaagacgcatggcgtgaacgacatcaccgtggtcggcggctatcgc
gccgacgcgatcgacacgtcgggcatcaagctcgtcgtcaacgagcgccatgcgcagacg
ggcgagctcgcgtcgctcgcgtgcgcggccgaacgcctgaccggcgacaccgtgatctcg
tacggcgacctgctgttccgcagctacatcgtgcgcgacctcgcggaaagcgaagccgaa
ttcagcgtcgtggtcgattcgtcgctcacggagtcgacgaaccagagcgtgcgcgacttc
gccctctgctcggcggccgacgatcgcggcctgttcggccagaagacctacctgcaacgc
gtatcgagcgacgtcgccgcgggcaccccgcacggccgctggatcggcctgctgaacgtg
cgcggcgccggcgtcgaccggctgaaggcgatgctcgcgacgctgcaggcgcgccctgat
ttcgacacgctcgacatcccgtcgctgctcaacgagctggtcgccgcgggcgagaagatc
gaggtgcagtacgtgcacggccactggcgcggcgtcaacgatctggaagacttccgccgc
gcgggcgacttcgcgcacggccagacgccgctgtccgagccgggcgccggcaacgggggc
gcgcaatga

DBGET integrated database retrieval system