KEGG   Burkholderia cepacia DDS 7H-2: DM42_3875Help
Entry
DM42_3875         CDS       T03302                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bced  Burkholderia cepacia DDS 7H-2
Brite
KEGG Orthology (KO) [BR:bced00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DM42_3875 (ahpF)
Enzymes [BR:bced01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DM42_3875 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_binding_3 DAO K_oxygenase Thi4 Glutaredoxin NAD_binding_8 FAD_oxidored FMO-like
Motif
Other DBs
NCBI-ProteinID: AIO45330
UniProt: A0A095F5K1
LinkDB All DBs
Position
2:431951..433552
Genome map
AA seq 533 aa AA seqDB search
MLDANLKNQLKAYLEKITRPIELVASLDDSAKSQELLALLNEIASLTDRVTVTERRDDAE
RKPSFSIGEPGKPAGIRFAGIPMGHEFTSLVLALLQTGGHPIKLDDDVIEQIRALDGDYA
FETFFSLSCQNCPEVVQALNVMSLINPRIRHVAIDGALFQDEVESRQIMAVPTMFLNGAS
FGQGRSSVKEILAKLDTGAGERAAKSLENKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKQYDVDIMDVQRADALIPGDVHQ
IRLANGAVLKAKTIVLATGARWREINVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVKEVTLIEYGAQLRADEVLQRKLRSLPNVTIVTQAQTTELTGDGSKL
NGLVYKDLRSGETKRVDLEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLGAFDHLIRQDVAAPAATAQPRVEEAVAA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctcaagaaccaactcaaagcgtacctcgaaaaaatcacgcgcccg
atcgaactcgtcgcctcgctcgacgacagcgcgaaatcgcaggaactgctggcgctgctg
aacgagattgcgtcgctgacggatcgcgtgaccgtgaccgaacgccgcgacgacgccgag
cgcaagccgtcgttctcgatcggcgagcccggcaagccggccggcatccgtttcgccggc
atcccgatgggccatgaattcacgtcgctcgtgctcgcgctgctgcagacgggcggccat
ccgatcaagctcgacgacgacgtgatcgaacagattcgcgcgctcgacggcgactacgca
ttcgaaacgtttttctcgctgtcgtgccagaactgcccggaagtcgtgcaggcgctgaac
gtgatgtcgctgatcaacccgcgcatccgccacgtcgcgatcgacggcgcactgttccag
gatgaagtcgagtcgcgccagatcatggccgtgccgacgatgttcctgaacggcgcgtcg
ttcggccagggccgcagcagcgtgaaggaaatcctcgcgaagctcgatacgggcgccgga
gaacgcgcggcgaagtcgctcgaaaacaagccggtgttcgacacgctgatcgtcggcggc
ggcccggcgggcgcggctgctgcgatctactccgcacgcaagggcatcgcgacgggtgtc
gtcgccgagcgtttcggcggccaggtgctggacacgatggcgatcgagaacttcgtgtcg
gtgcaggaaaccgaagggccgaagttcgcgaccgcactcgagcagcacgtcaagcagtac
gacgtcgacatcatggacgtgcaacgcgccgacgcgctgatcccgggcgacgtgcaccag
atccgtctcgcgaacggcgcggtgctgaaagcgaagacgatcgtcctcgcgaccggcgca
cgctggcgtgaaatcaacgtgccgggcgagcgcgaataccgcaaccgcggggtcgcgtac
tgcccgcactgcgacggcccgctgttcaagggcaagcgggtcgcggtggtcggcggcggc
aactcgggcgtcgaggccgcgatcgacctcgccggcatcgtgaaggaagtcacgctgatc
gaatacggcgcgcaactgcgcgcggacgaagtgctgcaacgcaagctgcgcagcctgccg
aacgtgacgatcgtcacgcaagcgcagacgaccgaactgaccggcgacggcagcaagctg
aacgggctcgtctacaaggatctgcgttccggtgaaacgaagcgcgtcgacctcgaaggc
gtgttcgtgcagatcggcctcgtgccgaacaccgaatggctgaaaggcacggtcgaactg
tcgaagcacggcgagatcgtcgtcgatgcgcgcggcgcgacgtcggtgccgggcgtgttc
gcggccggtgacgtgacgacggtgccgttcaagcagatcgtgatcgcggtcggcgaaggg
gcgaaggcgtcgctcggcgcgttcgaccacctgatccggcaggacgtggcggcgccggcc
gccaccgcgcagccgcgagtcgaagaagcggtcgccgcctga

DBGET integrated database retrieval system