KEGG   Burkholderia cepacia DDS 7H-2: DM42_4107Help
Entry
DM42_4107         CDS       T03302                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bced  Burkholderia cepacia DDS 7H-2
Pathway
bced00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bced00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    DM42_4107
Enzymes [BR:bced01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     DM42_4107
Transporters [BR:bced02000]
 Other Transporters
  Pores ion channels [TC:1]
   DM42_4107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: AIO45665
UniProt: A0A095E7Y2
LinkDB All DBs
Position
2:676769..677494
Genome map
AA seq 241 aa AA seqDB search
MRYELYYWPEIQGRGEYVRLALEAAEADYVDVARESGRGMGVTAMMRMMDSTQAECVPFA
PPFLKAGDVVVGQTANILLFLGARLGLAPDDEAGRLWVHQIQLTAADFITEIHDTHHPIG
SGLYYEDQKAEAAERAADFLENRLPKFLGYFDRVLEQNPHKNGYIAGNALSYADLTMFQL
IEGLRYAFPKAMKRAERKVAALVALHDRVAEHPPVARYLASERRIPFNDMGIFRHYPELD
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgcgatatgaactctattactggcccgagatccagggccgcggcgagtacgtacggctc
gcgctcgaggccgccgaagccgactacgtcgacgtcgcgcgcgaatcggggcgcggaatg
ggcgtgacggccatgatgcgcatgatggacagcacgcaggccgaatgcgtgccgttcgca
ccgccgttcctgaaggcgggcgacgtggtcgtcgggcagaccgcgaacatcctgctgttt
ctcggcgcgcggctcgggctcgcgcccgacgacgaagccggccggctgtgggtgcatcag
atccagctgaccgctgccgatttcatcaccgagatccacgacacgcaccatccgatcggc
agcggcctgtactacgaggaccagaaagcggaagcggccgagcgcgcggccgatttcctc
gagaaccggctgccgaagttccttggctacttcgatcgcgtgctcgaacagaatccgcac
aagaacggttatatcgcgggcaacgcgctcagctatgcggacctgacgatgttccagttg
atcgaggggctgcgctatgcgttcccgaaggcgatgaagcgcgcggagcgcaaggtcgcg
gcgctcgtcgcgctgcacgatcgcgtcgcggagcatccgcccgtcgcgcgctacctggca
tcggagcgccgcatcccgttcaacgacatggggatcttccggcactatccggagctggac
aagtaa

DBGET integrated database retrieval system