KEGG   Burkholderia cepacia DDS 7H-2: DM42_5056Help
Entry
DM42_5056         CDS       T03302                                 

Definition
(GenBank) D-xylulose reductase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
bced  Burkholderia cepacia DDS 7H-2
Pathway
bced00040  Pentose and glucuronate interconversions
bced01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bced00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DM42_5056
Enzymes [BR:bced01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     DM42_5056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: AIO45924
UniProt: A0A095ED01
LinkDB All DBs
Position
2:1684030..1685064
Genome map
AA seq 344 aa AA seqDB search
MKALVLERTRELALRDIDLPQAVGPGDVRIKVHTVGVCGSDVHYYVHGGIGPFRVDAPMV
LGHEASGTVVETGADVTHLRVGDRVCMEPGVPRLDSPATLRGLYNLDPDVRFWATPPIHG
CLTPFVVHPAAFTYRLPDNVSFAEGAIVEPLSIGLQAAKKAAMKPGDLAVVIGAGTIGAM
TALAALAGGAARVILADVVPDKLALFAGNPAVTTVDVRTRPLADAVAEASGGWGADVVFE
ASGSANAYAGLVDLMCPGGCAVLIGMPVAPVPLDVVALQAKEGRIESVFRYANIFPRALA
LIASGAIDVKPFISRTFPFSEGVRAFEEAASGHPRDVKIQIEMD
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagcgctcgtactcgaacgcacgcgcgagctcgcgctgcgcgacatcgacctgccg
caagcggtcggccccggcgacgtccggatcaaggtccatacggtcggcgtctgcggcagc
gacgtgcattactacgttcacggcgggatcggcccgttccgcgtcgacgcgccgatggtg
ctcggccatgaagcgtccggcacggtcgtcgagaccggcgccgacgtcacgcacctgcgc
gtcggcgaccgcgtgtgcatggagcccggcgtgccgcgcctcgattcgcccgcgacgctg
cgcgggctctacaacctcgatcccgacgtgcgcttctgggcgacgccgccgatccacggc
tgcctgacgccgttcgtcgtgcatccggccgcgttcacgtaccggctgcccgacaacgtg
tcgttcgccgaaggcgcgatcgtcgagccgctgtcgatcggcctgcaggccgcgaagaag
gcggcgatgaagcccggcgacctcgcggtcgtgatcggcgccggcacgatcggcgcgatg
acggcgctcgccgcgctcgccggcggcgccgcgcgcgtgattctcgccgacgtcgtgccg
gacaagctcgcgctgttcgccggcaacccggccgtcacgaccgtcgacgtgcgtacgcgg
ccgctggccgacgcggtggccgaagcgtccggcggctggggcgcggacgtcgtgttcgag
gcgagcggcagcgcgaatgcgtatgcgggcctcgtcgacctgatgtgcccgggcggctgc
gcggtgctgatcgggatgccggtcgcgccggtgccgctcgacgtggtcgcgctgcaggcg
aaggagggccgcatcgaatcggtgttccgctacgcgaacatcttcccgcgcgcgctcgcg
ctgatcgcgtccggcgcgatcgacgtgaagccgttcatctcgcgcacgttcccgttttcc
gaaggcgtgcgcgcgttcgaggaagcggcgagcggacacccgcgcgacgtcaagattcag
atcgaaatggattga

DBGET integrated database retrieval system