KEGG   Burkholderia cepacia DDS 7H-2: DM42_5108Help
Entry
DM42_5108         CDS       T03302                                 

Gene name
alkJ
Definition
(GenBank) alcohol dehydrogenase acceptor
Organism
bced  Burkholderia cepacia DDS 7H-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_N GMC_oxred_C DAO FAD_binding_2 Pyr_redox_2 FAD_oxidored Pyr_redox_3 HI0933_like NAD_binding_8 Lycopene_cycl Amino_oxidase Pyr_redox GIDA ApbA OCD_Mu_crystall FAD_binding_3 Thi4
Motif
Other DBs
NCBI-ProteinID: AIO46599
UniProt: A0A095EBU5
LinkDB All DBs
Position
2:1741092..1742657
Genome map
AA seq 521 aa AA seqDB search
METYDHIVVGGGSAGCTVAHRLVKAGRRVLLLEDGPKDDSLFIRIPATFIRVLGTQRTVT
FESEPQPGAAGRKTYVPQGRTLGGGSSVNAMLYVRGTRDDYDDWAALGCTGWGWDDVLPV
FKRAESHLRLSEPFHGTDGPLKVGDTRFRHPLSLAFVKAAQEAGIAYNDDFNGAAQHGVG
FYHTTIFDGQRGSTAATYLADAIADPNLRVLTGCRVTRIRFDGRRASGVEWRTASGATGA
AAARADVVLAAGALSTPKLLMLSGIGPGAHLHAHGIDVLHDSRDVGAHYQDHLEVSIYGR
TQAPVSLLGEDRGWRALRHGLQWMLCRSGLLTSNVVESGAFVDTTGGGRPDIQFHVLPTL
VGDVDRAPLPGHGLSINPCLLRPRSRGTVQLRGNDPAAPILFDSGALSDPADVEGLVRGV
RLARQILRAPSLARLMREAETLTDAALADYVRRRAKTVYHPAGTCRMGSDAHAVVTPRLA
VQGVDGLRICDASVMPRIVSGNTNAPTIMIAERCAAFMLTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggagacgtacgaccacatcgtcgtcggcggcggttcggccggctgcacggttgcgcac
cggctggtgaaggccggccggcgcgtgttgctgctcgaggacggcccgaaggacgacagc
ctgttcatccggattccggcgacgttcatccgcgtgctcggcacgcaacggacggtgacg
ttcgagagcgagccgcagccaggcgccgcgggacgcaagacctacgtgccgcagggccgc
acgctcggcggcggcagctcggtcaacgcgatgctgtacgtgcgcggcacgcgcgacgac
tacgacgactgggccgcgctcggctgcactggctggggctgggacgacgtgctgccggtg
ttcaagcgcgccgaatcgcatctgcggctgtcagagccgttccacggcaccgacgggccg
ttgaaggtcggcgacacgcgcttccggcatccgctgagcctcgcgttcgtgaaggccgcg
caggaagccggcatcgcgtacaacgacgacttcaacggcgccgcgcagcatggcgtcggc
ttctatcacacgacgatcttcgacggccagcgcggcagcaccgcggccacctatctggcc
gacgcgatcgccgatccgaacctgcgcgtgctgaccggctgccgcgtgacgcgcatccgg
ttcgacgggcgccgcgcgagcggcgtcgaatggcgcaccgcgagcggcgcgacgggagcg
gccgccgcgcgcgccgacgtcgtgctcgcggccggcgcgctgagcacgccgaagctgctg
atgctgtcgggcatcggccccggcgcgcacctgcacgcgcacggcatcgacgtgctgcac
gacagccgcgacgtcggcgcgcactaccaggatcacctcgaggtatcgatctacggccgc
acccaggcgccggtcagcctgctcggcgaggatcgcgggtggcgggcattgcggcacggg
ctgcaatggatgctatgccgctccggcctgctgacgtcgaacgtcgtcgaatcgggcgcg
ttcgtcgatacgaccggtggcggccgcccggacatccagttccacgtgctgccgacgctc
gtcggcgacgtcgaccgcgccccgctgcccggccacggcctgtcgatcaacccgtgcctg
ctccggccgcgctcgcgcggcaccgtgcaactgcgcggcaacgatccggccgcgccgatc
ctgttcgacagcggcgcgctgtcggacccggccgacgtcgagggcctcgtgcgcggcgtc
aggctcgcgcggcagattctccgcgcgccgtcgctcgcccgcctcatgcgcgaagccgag
acgctgaccgacgccgcgctcgccgactacgtgcggcgtcgcgcgaaaaccgtctatcac
ccggccggtacgtgccgcatgggcagcgacgcgcacgcggtcgtcacgccgcgtctcgcc
gtgcaaggcgtcgacgggttgcggatctgcgatgcatcggtgatgccgcgcatcgtgtcc
ggcaacacgaacgcgccgacgatcatgatcgcggagcgctgcgcggcgttcatgttgacg
gcgtga

DBGET integrated database retrieval system