KEGG   Burkholderia cepacia DDS 7H-2: DM42_5109Help
Entry
DM42_5109         CDS       T03302                                 

Definition
(GenBank) helix-turn-helix domain protein
Organism
bced  Burkholderia cepacia DDS 7H-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AraC_binding_2 HTH_18 HTH_AraC
Motif
Other DBs
NCBI-ProteinID: AIO44476
UniProt: A0A095ECL0
LinkDB All DBs
Position
2:complement(1742753..1743733)
Genome map
AA seq 326 aa AA seqDB search
MTNSTVFSRTRGSTADVPARDRMAYWDAFNAATLVGLRCSSLSPAGLEVEKTDIALPGLG
IADISGQDHVIERSPALVRQLPKESLFACQILSGRAYFIQRDRCLLAEAGDVVVYDTRVP
YLFGFLTPMRQLLIDIPITTLDDRLDAELAALPLRIAPKPGAGAMLGATLRASVERFMKA
PVERDAARFAEHTRTLIAALVDAEVNGAGASRASLSYLLTAKQYIATHLGEPELGPQAVA
DAVGLSLRHLGRLFAAEGESITQHIWSERLSHAHRELTDARLRKTSIGEIAFRWGFSSQA
HFSRAIRERYGASPMALRDAARDAAG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaattcgaccgttttttcacgcacgcgaggttcgacggccgacgtgccggcgcgc
gacaggatggcgtactgggatgcgttcaacgcggcgacgctggtcggcctgcgctgctcg
tcgctgtcgccggccgggctcgaagtggagaagaccgacatcgcgctgccgggcctcggc
atcgccgacatcagcgggcaggatcacgtgatcgagcgcagcccagcgctggtgcgccag
ttgccgaaggaatcgctgttcgcgtgccagatcctgagcgggcgcgcgtatttcatccag
cgcgaccggtgcctgctcgcggaagccggcgatgtcgtcgtctacgacacgcgcgtgccg
tatctgttcggattcctgacgccgatgcggcagttgctgatcgatatcccgatcacgacg
ctcgacgaccgcctcgatgcggagctggccgcgctgccgctgcggatcgcgccgaagccg
ggtgcgggcgcgatgctcggcgcgaccttgcgcgcgagcgtcgagcggttcatgaaggcg
ccggtcgagcgcgacgccgcgcggttcgccgagcacacgcgcacgctgatcgcggcgctc
gtcgatgcggaggtgaacggcgcgggcgcatcgcgcgcgtcgctgtcgtacctgctgacc
gcgaagcaatacatcgcgacgcatctcggcgaaccggaactcgggccgcaggccgtcgcc
gatgcggtcgggctgtcgctgcggcatctggggcgcctcttcgcggccgaaggcgagtcg
atcacgcagcacatctggtcggagcggttgtcgcacgcgcatcgcgaactgaccgacgcg
cggctgcgcaagacgagcatcggcgagatcgcgtttcgctgggggttttcgagccaggcg
cacttcagccgcgcgatccgcgagcgctacggcgcgtcgccgatggcgctgcgcgacgcg
gcgcgtgacgccgcgggctga

DBGET integrated database retrieval system