KEGG   Burkholderia cepacia DDS 7H-2: DM42_5111Help
Entry
DM42_5111         CDS       T03302                                 

Definition
(GenBank) lacY proton/sugar symporter family protein
Organism
bced  Burkholderia cepacia DDS 7H-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr LacY_symp MFS_1_like
Motif
Other DBs
NCBI-ProteinID: AIO45773
UniProt: A0A095EBH6
LinkDB All DBs
Position
2:1744465..1745769
Genome map
AA seq 434 aa AA seqDB search
MTSPSSSRPAWTYENRLLLILFMTFGFVFFDRLALSFLFPFMSAELHLTNTQLGMVSSAL
ALTWALSGAATGAWSDARGTRKPLLIAAVLGFSVCSALSGLVGGFASLIAFRALMGIAEG
PVLPLSQSLMVESSTPSRRGLNMGLLQGSAAGLLGAMIGPPVVIGIATAYGWREAFYVSC
IPGFLIAFCIWRWVREVPPGGVRHAQADTTAAPAAGGATVSRWALLKERNILLCVLISCF
FLTWFVVIISFAPVFLVESRHLSPADMGVVMTCLGAAWVFWGFAVPAISDRIGRKPTMIA
FALIAAVCPVVLIHVGSVWALGALVFVTYTGLGCFTLFMATIPAETVPPRAIASALGLIM
GAGELIGGFVAPTVAGFAADKYGLQFAMWTSTTGAILACVLSFGLVETAPAVLRKRALAG
AAAGRLDTQNLGGR
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgacttccccgtcctcctcccggcccgcctggacgtacgagaacaggctgctgctgatc
ctgttcatgacgttcggcttcgtgttcttcgaccgcctcgcgctgtcgttcctgtttccg
ttcatgtcggccgagctgcacctgacgaacacgcagctcggcatggtgtcgtccgcgctc
gcactcacgtgggcgctgtcgggcgccgccacgggtgcatggtccgacgcgcgcggcacc
cgcaagccgctgctgatcgcggccgtgctcggcttttccgtgtgctcggcgctgtcgggc
ctcgtcggcggcttcgcgagcctgatcgcgtttcgcgcgctgatgggcatcgccgaaggg
ccggtgctgccgctgtcgcaatcgctgatggtcgaaagttcgacgccgagccgccgcggg
ctgaacatgggcctgctgcagggctcggccgccggcctgctcggcgcgatgatcggcccg
ccggtcgtgatcggcatcgccaccgcgtacggctggcgcgaggcgttctacgtgtcgtgc
attccgggcttcctgatcgcgttctgcatctggcgctgggtgcgcgaagtgccgcccggc
ggcgtgcgccacgcgcaggccgacaccaccgcggcaccggccgccggcggtgcgacggtc
agccgctgggcgctgctgaaggagcgcaacatcctgctctgcgtgctgatcagctgcttc
ttcctcacgtggttcgtcgtgatcatctcgttcgcgccggtattcctcgtggaaagccgc
cacctgtcgccggccgacatgggcgtcgtgatgacctgcctcggcgccgcgtgggtgttc
tggggcttcgcggtgccggcgatctccgaccggatcggccgcaagccgacgatgatcgcg
ttcgcgctgatcgcggccgtgtgcccggtcgtgctgatccacgtcggttccgtctgggcg
ctcggcgcgctggtgttcgtcacgtacacgggcctcggctgcttcacgctgttcatggcg
acgatcccggccgagacggtgccgccgcgcgcgatcgcgagcgcgctcgggctgatcatg
ggcgccggcgagctgatcggcggcttcgtcgcaccgaccgtcgccggcttcgccgcggac
aagtacggcctgcagttcgcgatgtggacgtcgaccaccggcgcgatcctcgcgtgcgtg
ctgtcgttcggcctcgtcgaaaccgcgccggccgtgctgcgcaagcgcgcgctcgccggc
gccgcggccggccgcctcgatacgcaaaacctcggaggacgctga

DBGET integrated database retrieval system