KEGG   Burkholderia cepacia DDS 7H-2: DM42_5112Help
Entry
DM42_5112         CDS       T03302                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bced  Burkholderia cepacia DDS 7H-2
Pathway
bced00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bced00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DM42_5112
Enzymes [BR:bced01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     DM42_5112
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     DM42_5112
    1.1.1.-  
     DM42_5112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C ADH_N_assoc Methyltransf_25 TrkA_N Methyltransf_11 Methyltransf_12 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AIO46236
UniProt: A0A095F7Q7
LinkDB All DBs
Position
2:1745771..1746892
Genome map
AA seq 373 aa AA seqDB search
MRALQWHGPRDVRLVEIDTPHVGPGDVRIAVAYCGICGSDLHEYADGPHAIPVDAPHPLS
RRTAPLTLGHEFCGTVVEVGAGVTTLRAGDRVAVEPEYRCSQCAYCRAGSYNLCVSMGFA
GLMGDGGMADFAVVPAYMLHRLPDGVSLEQAAVMEPAAVALHALRRGELRLGETCAVFGL
GPIGLLLIMLAKRQGATTIVAIDVSPERLAAATRFGATHAFDARGLDASALQDAIRAATG
GLGVDASFEAAGLQATFESAMRALRKGGRVVMVGLMPHAGFDAFRAVNDELTFTASVGYR
HAYEDLLRIVASGALDLTSIVTRTVSLEDAVADGFDALLADRTQIKILVSPAQRPARRAT
TIGSAEHESSVGV
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcacttcaatggcatggcccgcgcgacgtccgtctcgtggaaatcgacacgccg
cacgtcggccccggcgacgtgcgcatcgcggtcgcatattgcggcatctgcggcagcgac
ctgcacgaatatgcggacggcccgcacgcgattccggtcgacgcgccgcatccgctgtcg
cgccgcaccgcgccgctgacgctcggccacgagttctgcggcaccgtcgtcgaagtcggc
gcaggcgtgacgacgctgcgcgcgggcgaccgcgtcgcggtcgagcccgagtatcgctgc
agccagtgcgcgtactgccgcgcggggtcgtacaacctgtgcgtgtcgatgggcttcgcc
gggctgatgggcgacggcgggatggccgacttcgcggtcgtgcccgcctacatgctgcat
cgcctgcccgacggcgtgagcctcgaacaggccgcggtgatggagccggccgccgttgcg
ctgcacgcgctgcgacgcggcgagctgcggctcggcgagacctgcgcggtgttcgggctc
ggcccgatcggcctgctgctgatcatgctcgcgaagcggcagggtgcgacgacgatcgtc
gccatcgacgtgtcgcccgaacggctcgcggccgccacgcgcttcggcgcgacgcatgcg
ttcgatgcgcgcgggctcgatgcgtccgcgctgcaggacgcgattcgcgcggccacgggc
gggctcggcgtcgatgcgagcttcgaggcggccggattgcaggccacgttcgaatcagcg
atgcgggcactgcgcaagggcggccgcgtcgtgatggtgggcctgatgccgcacgcgggt
ttcgacgcgttccgcgcggtcaacgacgaactgaccttcaccgcgagcgtcggctatcgg
catgcgtacgaagacctgctgcgcatcgtcgcgtcgggcgcgctcgacctcacgtcgatc
gtcacgcgcaccgtgtcgctcgaagacgccgtcgccgacggcttcgacgcgctgctcgcc
gatcgcacgcagatcaagatcctcgtttcacccgcgcagcggccagcccgtcgcgccacc
accatcgggagtgccgaacatgaatcgtcagtgggcgtttga

DBGET integrated database retrieval system