KEGG   Burkholderia cepacia DDS 7H-2: DM42_5113Help
Entry
DM42_5113         CDS       T03302                                 

Definition
(GenBank) short chain dehydrogenase family protein
Organism
bced  Burkholderia cepacia DDS 7H-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase Glyco_trans_4_4 KR Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: AIO44638
UniProt: A0A095E5M8
LinkDB All DBs
Position
2:1746870..1747592
Genome map
AA seq 240 aa AA seqDB search
MNRQWAFDGQSVVVTGGTSGIGARTALRFAQAGASVVALGLDAAGPHAPVHDRIRCVELD
VADGAALTRTIAGLPRLGALVNGVGISRHADEYRMDQFEHVLNVNLTSVMRASGAALPAL
AATGGSIVNIASMYTYFGSKDRPAYSASKGGIAQLTRSLAQAWADHGIRVNAVAPGWIDT
PLSSALMADTQASRRIVERTPLGRWGTTDEVAEVILFLCSPGASFVTGAVVPVDGGYSTV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtcagtgggcgtttgacgggcagtccgtcgtggtgacgggcggcacgtcgggc
atcggcgcgcgcaccgcgctgcggttcgcgcaggccggcgcgtcggtcgtcgcgctcggg
ctcgacgccgccggtccgcacgcgccggtgcatgaccgcatccggtgcgtggaactcgac
gtggccgacggcgcggcactgacgcgtacgatcgccgggctgccgcggctcggcgcgctc
gtcaacggcgtcggcatcagccgccacgcggacgaataccggatggaccagttcgagcac
gtgctgaacgtgaacctgacgtcggtgatgcgggcctccggcgccgcgctgcccgcgctg
gcggccaccggcggcagcatcgtcaatatcgcgtcgatgtacacgtacttcggcagcaag
gaccggcccgcgtacagcgcgagcaagggcggcatcgcgcagctcacgcgttcgctcgcg
caggcgtgggccgatcacggcatccgtgtgaacgcggtcgcgccgggctggatcgacacg
ccgctcagcagcgcgctgatggccgacacgcaggcgtcgcgccgcatcgtcgagcgcacg
ccgctcgggcgctggggcacgaccgacgaagtcgcggaagtgatcctgttcctgtgctca
cccggcgcgtcgttcgtcaccggcgcggtcgtgccggtggacggcgggtattcgacggtc
tag

DBGET integrated database retrieval system