KEGG   Burkholderia cepacia DDS 7H-2: DM42_5116Help
Entry
DM42_5116         CDS       T03302                                 

Definition
(GenBank) ribosomal natural product, two-chain TOMM family protein
Organism
bced  Burkholderia cepacia DDS 7H-2
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AIO45396
UniProt: A0A095EAB2
LinkDB All DBs
Position
2:complement(1751263..1751625)
Genome map
AA seq 120 aa AA seqDB search
MAKDNANPTLESMLEFQKVYLRAIALSWRDPAFKTELLDRPLDTLAKYFGYQCPWIIDID
IEKTGGDHGWTSDGKGGGSWNLPRNVMTVGIPEQPAHLDEEAVALAAYCDAGPCYLFTCC
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggacaacgcgaatccgacgctcgaatcgatgctggagtttcagaaggtctat
ctgcgtgcgatcgcgctttcgtggcgcgacccggcgttcaagaccgaattgctggaccgg
ccgctggatacgctcgcgaaatacttcggctatcagtgcccgtggatcatcgacatcgat
atcgagaagacgggcggcgatcatggctggacgagcgacgggaaaggcggcgggagctgg
aacctgccgcgcaacgtgatgacggtcggcataccggagcagccggcgcacctggacgag
gaggccgtggcgctcgcggcctactgcgacgcggggccgtgttacctgttcacctgctgt
tga

DBGET integrated database retrieval system