KEGG   Burkholderia cepacia DDS 7H-2: DM42_5135Help
Entry
DM42_5135         CDS       T03302                                 

Definition
(GenBank) hypothetical protein
Organism
bced  Burkholderia cepacia DDS 7H-2
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AIO45546
UniProt: A0A095E7D6
LinkDB All DBs
Position
2:1770815..1771231
Genome map
AA seq 138 aa AA seqDB search
MKPDVRKRDDDDDRARLAIRQARVRAALRLRGVMKLTIVTIAVAHVLTFAFEGVLAAAGF
APDAAAVLLFRFVTCALVSFWLQADALRAYRYAAQHGFVTAPGAHGDPLDVAPQCPKRWL
VVLSLQLDPRGSNGERIK
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacccgatgtgcgcaagcgcgatgacgacgacgatcgcgcacggctcgccatccgg
caggcacgcgtgcgggcggcgctaaggctgcgtggcgtgatgaagctgacgatcgtcacg
atcgcggtggcgcacgtgttgacgttcgcgttcgaaggcgtgctggccgcagccggtttc
gcaccggacgcggcggccgtgctgctgttccgcttcgtgacgtgcgcgctcgtgagcttc
tggctgcaggcggatgcgttgcgcgcgtaccggtacgcggcgcaacacgggttcgtcacg
gctcccggtgcgcatggcgatccgctcgacgttgcgccgcagtgtccgaagcgctggctc
gtcgtgttgagccttcagctcgacccgcgcggatcgaatggtgaacggatcaagtag

DBGET integrated database retrieval system