KEGG   Burkholderia cepacia DDS 7H-2: DM42_5136Help
Entry
DM42_5136         CDS       T03302                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
bced  Burkholderia cepacia DDS 7H-2
Pathway
bced00260  Glycine, serine and threonine metabolism
bced01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bced00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DM42_5136 (tdh)
Enzymes [BR:bced01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     DM42_5136 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 FAD_binding_3 Methyltransf_25 Pyr_redox_3 Methyltransf_16
Motif
Other DBs
NCBI-ProteinID: AIO46487
UniProt: A0A095EAK1
LinkDB All DBs
Position
2:complement(1771630..1772658)
Genome map
AA seq 342 aa AA seqDB search
MKALAKLERGPGLTLTRVKRPEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQKTIPVPMH
VGHEYVGEIVEMGQEVRGFAIGDRVSGEGHITCGFCRNCRAGRRHLCRNTVGVGVNREGA
FAEYLAIPAFNAFKIPPEISDDLASIFDPFGNATHTALSFNLVGEDVLITGAGPIGIMAV
AIAKHVGARNVVITDINDYRLELARKMGATRAVNVARESLRDVMADLHMTEGFDVGLEMS
GVPSAFTSLLEAMNHGGKVALLGIPPAQTAIDWNQVIFKGLEIKGIYGREMFETWYKMVA
MLQSGLDLSPIITHRFAADDYEQGFAAMLSGESGKVILDWTV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactggcaaagctcgaacgcggccccggccttacgctcacgcgggtgaagcgc
cccgaagtcggccacaacgacgtgctgatcaagatccgccgcacggcgatctgcggcacc
gacatccatatctggaagtgggacgactgggcgcagaagacgattccggtgccgatgcac
gtcggccacgaatacgtcggcgagatcgtcgagatggggcaggaagtgcgcggcttcgcg
atcggcgatcgcgtgtccggcgaaggtcacatcacgtgcggtttctgccgcaactgtcgc
gccgggcgccggcatctgtgccgcaacacggtgggcgtcggcgtgaaccgcgaaggcgcg
ttcgccgaatacctggcgattccggcattcaacgcgttcaagattccgccggagatttcc
gacgatctcgcgtcgatcttcgatccgttcggcaacgcgacgcacacggcgttgtcgttc
aacctcgtcggcgaggacgtgctcatcaccggcgccggcccgatcggcatcatggccgtc
gcgatcgcgaagcacgtcggcgcgcgcaacgtcgtcatcaccgatatcaacgactatcgg
ctcgagctcgcgcgcaagatgggcgcgacgcgggcggtcaacgtcgcgcgcgagtcgctg
cgcgacgtgatggccgacctgcacatgaccgaaggcttcgacgtcggtctcgagatgtcg
ggcgtgccgagcgcgttcacgagcctgctcgaggcgatgaaccacggcggcaaggttgcg
ctgctcggcatcccgcccgcgcagacggcgatcgactggaaccaggtgatcttcaagggg
ctcgagatcaagggcatctacggccgcgagatgttcgagacctggtacaagatggtcgcg
atgctgcagagcggcctcgacctgtcgccgatcatcacgcaccgcttcgcggccgacgat
tacgagcaaggcttcgccgcgatgctgtccggcgaaagcggcaaggtgattctcgactgg
accgtctga

DBGET integrated database retrieval system