KEGG   Burkholderia cepacia DDS 7H-2: DM42_5141Help
Entry
DM42_5141         CDS       T03302                                 

Definition
(GenBank) hypothetical protein
Organism
bced  Burkholderia cepacia DDS 7H-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: KfrA_N TPR_MLP1_2 Filament ADIP DUF1664 DUF4407 HAP1_N Lar_restr_allev ATG16 Dynactin_p22 Tup_N AAA_13 Lectin_N
Motif
Other DBs
NCBI-ProteinID: AIO44493
UniProt: A0A095E7V0
LinkDB All DBs
Position
2:complement(1776419..1777600)
Genome map
AA seq 393 aa AA seqDB search
MTLDEMRQVIREELESLRASGARRQELSLHACKRLFFDLGIRPSAANVRDLTQTGSASDI
PKDIDHFWERIRSASKIRLDGAAIPKAVEEKAGALLGALYEEALKAARDSLDGDREQVRA
DMAEAEQRLRDATVRQETLEGALARGEARNEQLQARVTELEVQLASQTTHGSASEATLLT
TVARLEKELAAAAGRIEAEQAQNVALRDRIDALQAELQQRTEHYAQQIKDAVAEAERRVK
PMLVELDSLRSMASTYQSGLRDVQRKEFDFLQQLSSAKARADRLEEQLRTQSDELERATR
DVSSLRANRGMNPEIAALIRRLAEAGRLDADAYAAIGTALDHEIPAPTQCPHCDGEPELS
HGDEGFEVACPECEHASGTWPSRFEAVARFAHT
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccctggacgaaatgcgtcaagtcattcgggaagaactggaatcgctgcgcgcaagc
ggtgcacggcgccaggaactgtcactgcatgcgtgcaaacgcttgttcttcgatctcggt
atccggccgtcggccgccaacgtccgcgatctcacccagaccggcagcgccagcgacatc
ccgaaagacatcgaccatttctgggagcgcattcgttccgcgtccaagatcaggctggac
ggcgcggcgatcccgaaagccgtcgaggaaaaggccggcgcgttgctgggcgcactctat
gaagaagcattgaaagcggcgcgcgacagcctcgatggcgaccgcgagcaggttcgcgcc
gacatggccgaagccgaacagcggttgcgtgacgcaaccgtccgccaggaaacgctcgaa
ggggcgctcgcgcgcggggaagcgagaaacgaacaattgcaggcgcgggtaaccgaactc
gaggttcagctcgcgtcgcaaacgactcacggttcggcaagcgaagcaacgttgctcacc
acagtcgcacgactggaaaaggaactggccgcggctgccggccggatcgaagccgaacag
gcacagaacgtcgccctgcgcgaccgcatcgatgcgctgcaagccgaattacagcagcgt
accgagcactatgcgcagcaaatcaaggatgcggtggccgaagccgagcgtcgcgtcaaa
ccgatgctggtcgaactggactcgttgcgcagcatggcgtcgacctaccagagcgggttg
cgcgacgtccagcgcaaggagttcgatttcctgcagcaattgagttcggccaaggcgcgc
gccgaccggctcgaagaacagctgcgtacgcagagcgacgaactggagcgcgcaacgcgt
gacgtgagttcgttgcgcgcgaaccgcggaatgaatccggaaatcgccgcgctgatccgg
cgcctggccgaggcgggacgactcgacgcggatgcgtatgccgcgatcggcaccgcgctg
gatcacgagattccggcgccgacccagtgcccgcattgcgatggcgaaccggaactgtcg
cacggcgacgaaggttttgaagtcgcgtgccccgagtgcgagcacgcttccggcacctgg
ccgtcccgcttcgaagccgtcgcgcgttttgcgcacacctga

DBGET integrated database retrieval system