KEGG   Burkholderia cepacia DDS 7H-2: DM42_5147Help
Entry
DM42_5147         CDS       T03302                                 

Definition
(GenBank) RNA polymerase sigma factor, sigma-70 family protein
Organism
bced  Burkholderia cepacia DDS 7H-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r2 Sigma70_r4_2
Motif
Other DBs
NCBI-ProteinID: AIO46751
UniProt: A0A095F4W6
LinkDB All DBs
Position
2:complement(1784407..1785006)
Genome map
AA seq 199 aa AA seqDB search
MPSAYDDPTYLAQLRRDLLRFARLQLRDADAAEDAVQEALAAAWSHAGDFAGQSAHKTWV
FGILRNKLIDVLRARQRMVSLTALDAELDGESVLDRELFKDNGHWAAHAKPRPWPKPETL
LQQQQFWTLFQACLDHLPEQIGRVFMMREFLDVEIVDICSELTLTTNHCSVLLYRARTRL
RTCLSEKGLTTEDAAGEMY
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccgcatacgacgaccccacctatctcgcgcaactgcggcgcgacctgctgcgc
ttcgcgcgactccagctccgcgacgccgacgcggccgaagacgccgtgcaggaagcgctg
gccgccgcgtggtcgcatgccggcgatttcgccggacagtcggcccacaagacctgggtg
ttcggcatcctgcgcaacaagttgatcgacgtgctgcgcgcacggcagcggatggtgagc
ctgaccgcgctcgatgcggaactcgacggcgaatccgtgctcgatcgcgaactgttcaag
gacaacggtcactgggccgcgcacgcgaaaccgcgtccgtggccgaagcccgaaacgctg
ttgcagcagcagcaattctggacgctgttccaggcgtgcctcgaccatctgccggagcag
atcggacgcgtgttcatgatgcgcgaattcctcgatgtcgagatcgtggacatctgcagt
gaattgacgctgacgacgaatcattgcagcgtgctgctgtatcgggcgcgcacgcgcctg
cgaacctgcctgagcgaaaaaggactgacgaccgaagatgctgccggggaaatgtactga

DBGET integrated database retrieval system