KEGG   Burkholderia cepacia DDS 7H-2: DM42_5157Help
Entry
DM42_5157         CDS       T03302                                 

Gene name
shc
Definition
(GenBank) squalene-hopene cyclase
  KO
K06045  squalene-hopene/tetraprenyl-beta-curcumene cyclase [EC:5.4.99.17 4.2.1.129]
Organism
bced  Burkholderia cepacia DDS 7H-2
Pathway
bced00909  Sesquiterpenoid and triterpenoid biosynthesis
bced01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bced00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    DM42_5157 (shc)
Enzymes [BR:bced01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.129  squalene---hopanol cyclase
     DM42_5157 (shc)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.17  squalene---hopene cyclase
     DM42_5157 (shc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SQHop_cyclase_C SQHop_cyclase_N Prenyltrans Pec_lyase TED_complement
Motif
Other DBs
NCBI-ProteinID: AIO45324
UniProt: A0A095E921
LinkDB All DBs
Position
2:1794447..1796420
Genome map
AA seq 657 aa AA seqDB search
MNDLTEMATLSAGAVPAGVDAAVARATDALLAAQQADGHWVYELEADSTIPAEYVLLVHY
LGETPNLELEQKIGKYLRRIQQADGGWPLFTDGAPNISASVKAYFALKVIGDDENAEHMQ
RARRAIHAMGGAEMSNVFTRIQLALYGAIPWRAVPMMPVEIMLLPQWFPFHLSKVSYWAR
TVIVPLLVLNAKRPLAKNPRGVRIDELFIDPPVNAGLLPRQGHQSPGWFAFFRVVDHALR
AVDGLFPSYTRERAIRQAVSFVDERLNGEDGLGAIYPAMANSVMMYAALGYAEDHPNRAI
ARKSVEKLLVVHDDEAYCQPCLSPVWDTSLAAHALLETGDARAQEAVLRGLEWLRPLQIL
DVRGDWISRRPNVRPGGWAFQYANAHYPDVDDTAVVVMAMDRAQKLTQSDTYRESMARAR
EWVVGMQSSDGGWGAFEPENTQYYLNNIPFSDHGALLDPPTADVSGRCLSMLSQLGETPL
NSEPARRALDYMLKEQEPDGSWYGRWGMNYVYGTWTALCSLNAAGLTPDDPRMKRGAQWL
LSIQNKDGGWGEDGDSYKLNYRGYEQAPSTASQTAWALLGLMAAGEVNNPAVARGVDYLV
AQQNEEGLWDETRFTATGFPRVFYLRYHGYRKFFPLWALARYRNLKRANATRVTVGM
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatctcaccgaaatggctaccttgtccgccggcgccgtgccggccggcgtcgac
gcggccgtcgcgcgggcgaccgacgcgctgctggccgcgcagcaagcggacggccactgg
gtctacgaactcgaggcggattcgacgattcccgccgaatacgtgctgctcgtccactat
cttggcgagacgccgaacctcgagctcgaacagaagatcggcaagtatctgcgccgcatc
cagcaggccgacggcggctggccgctgttcaccgacggtgcgccgaacatcagcgcgagc
gtgaaggcctacttcgcgctgaaggtgatcggcgacgacgagaatgccgagcacatgcag
cgcgcgcgccgcgcgatccacgcgatgggcggcgccgagatgtcgaacgtgttcacgcgc
atccagctcgcgctctacggtgcgattccgtggcgcgcggtgccgatgatgccggtcgag
atcatgctgctgccgcagtggttcccgttccacctgtcgaaggtgtcgtactgggcgcgc
accgtgatcgtgccgctgctcgtgctgaacgcgaagcgaccgcttgcgaagaacccgcgc
ggcgtgcgcatcgacgagctgttcatcgacccgccggtcaacgccgggctgctgccgcgc
caggggcatcagagcccgggctggttcgcgttcttccgcgtggtcgaccatgcgctgcgc
gcggtcgacgggctgttcccgagctacacgcgcgaacgcgcgatccgccaggccgtgtcg
ttcgtcgacgagcgcctgaacggcgaggacggcctcggtgcgatctatccggcgatggcc
aactcggtgatgatgtacgccgcgctcggctatgcggaagatcatccgaaccgcgcgatc
gcgcgcaagtcggtcgagaagctgctcgtcgtgcacgacgatgaagcgtattgccagccg
tgcctgtcgccggtgtgggacacgtcgctcgccgcgcatgcgctgctcgaaaccggcgat
gcgcgtgcgcaggaagccgtgctgcgcggcctcgaatggctgcgcccgctgcagattctc
gacgtgcgcggcgactggatctcgcgccgcccgaacgtgcggcccggcggctgggcgttc
cagtacgcgaacgcgcactacccggacgtcgacgatacggccgtggtcgtgatggcgatg
gatcgcgcgcaaaagctcacgcaatcggacacgtatcgcgaatcgatggcgcgggcgcgc
gaatgggtcgtcggcatgcagagcagcgacggcggctggggcgcgttcgaaccggaaaac
acgcagtactacctgaacaacattccgttctccgatcacggcgcgctgctcgatccgccg
acggccgacgtgtcggggcgctgcctgtcgatgctgtcgcagctcggcgagacgccgctg
aacagcgagccggcccgccgcgcgctggactacatgctgaaggaacaggagccggacggc
agctggtacggccgctgggggatgaactacgtgtacggcacgtggaccgcgctgtgctcg
ctgaacgcggccggcctgacgccggacgacccgcgcatgaagcgcggcgcgcagtggctg
ctgtcgatccagaacaaggacggcggctggggcgaggacggcgacagctacaagctgaac
taccgcggttacgagcaggcgccgagcacggcgtcgcagacggcctgggcgttgctcggc
ctgatggcggccggcgaagtgaacaacccggccgtggcgcgcggcgtcgactacctggtt
gcccagcagaacgaagaaggcctgtgggacgagacgcgcttcaccgcgacgggcttcccg
cgcgtgttctatctgcgctaccacggctatcgcaagttcttcccgctgtgggcgcttgcg
cgctaccgcaacctgaagcgcgcgaacgcgacgcgcgtgacggtcgggatgtaa

DBGET integrated database retrieval system