KEGG   Burkholderia cepacia DDS 7H-2: DM42_5171Help
Entry
DM42_5171         CDS       T03302                                 

Definition
(GenBank) FAD binding domain protein
  KO
K00104  glycolate oxidase [EC:1.1.3.15]
Organism
bced  Burkholderia cepacia DDS 7H-2
Pathway
bced00630  Glyoxylate and dicarboxylate metabolism
bced01100  Metabolic pathways
bced01110  Biosynthesis of secondary metabolites
bced01120  Microbial metabolism in diverse environments
bced01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bced00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DM42_5171
Enzymes [BR:bced01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.15  (S)-2-hydroxy-acid oxidase
     DM42_5171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD-oxidase_C FAD_binding_4
Motif
Other DBs
NCBI-ProteinID: AIO45100
UniProt: A0A095F6C8
LinkDB All DBs
Position
2:complement(1813515..1815014)
Genome map
AA seq 499 aa AA seqDB search
MSFIYDERIDGPLATVDRATLVAALHAAAPGLDVLHEREALKPFECDGLAAYRTVPLAVV
LPDTVDQVRAVLRVAAAHGVPVVARGAGTGLSGGAMPLEKGILLVMAKFNRILDIDPDAG
IARVQPGVRNLAISQAAAPHGLYYAPDPSSQIACSIGGNVAENAGGVHCLKYGLTVHNIL
KVEILTIDGDTLTLGADALDAPGFDLLALFTGSEGMLGIVTEVTVKLLPKPPSVKVLMAS
FDDVAEAGAAVARIIGAGVIPGGLEMMDNLAIRAAEDFIHAGYPVDAQAILLCELDGAAS
DVDEDAERVAALLRDAGASEIRVARDEAERQRFWAGRKNAFPAVGRMSPDYYCMDGTIPR
RELPRVLEGIAALSAEYRLPVANVFHAGDGNMHPLILFDANRPGELDRAEALGGKILELC
VAAGGSITGEHGVGREKINQMCVQFNADEITFFHAVKAAFDPQGLLNPGKNIPTLHRCAE
FGAMHVHHGKLPFPELERF
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcatctacgacgaacggatcgacgggccgctggcgaccgtcgaccgcgccacc
ctcgtcgccgcgctgcacgcggcggcgcccggcctcgacgtgctgcacgaacgcgaggcg
ctcaagccgttcgaatgcgacgggctggccgcgtaccgcacggtgccgctcgcggtcgtg
ctacccgacacggtcgaccaggtgcgcgcggtgttgcgcgtcgcggccgcgcacggcgta
ccggtcgtcgcgcgcggcgcgggcaccggattgtcgggcggcgcgatgccgctcgaaaaa
ggcatcctgctggtgatggcgaagttcaaccggatcctcgacatcgaccccgatgccggc
atcgcgcgcgtgcaacccggcgtgcgcaatctcgcgatctcgcaggccgccgcgccgcac
ggcctctactacgcgcccgatccgtcgtcgcagatcgcgtgctcgatcggcggcaacgtc
gccgagaacgcgggcggcgtccactgcctgaaatacgggctcacggtgcacaacatcctg
aaggtcgagatcctgacgatcgacggcgacacgctcacgctcggcgccgacgcgctcgat
gcaccgggcttcgacctgctcgcgctgttcaccggctccgaagggatgctcggcatcgtc
accgaggtgacggtgaagctgttgccgaagccgccgagcgtgaaggtgctgatggcgagc
ttcgacgacgtcgccgaggcgggcgccgcggtcgcgcggatcatcggcgcgggcgtgatc
cccggcggcctcgagatgatggacaacctcgcgatccgcgcggccgaggacttcatccac
gcgggctatccggtcgacgcgcaggcgatcctgctgtgtgagctcgacggcgcggccagc
gacgtcgacgaggatgccgaacgcgtcgccgcgctgctgcgcgacgcgggcgcaagcgag
attcgcgtcgcgcgcgacgaagccgagcgccagcgcttctgggccggccgcaagaacgcg
ttcccggcggtcggccggatgtcgcccgactactactgcatggacggcacgatcccgcgc
cgcgagctgccgcgcgtgctcgaagggatcgccgcgctgtccgccgaataccggctgccg
gtcgcgaacgtgttccacgcgggcgacggcaacatgcacccgctgatcctgttcgatgcg
aaccggcccggcgagctcgaccgcgcggaagcgctcggcggcaagatcctcgagctgtgc
gttgcggcgggcggcagcatcaccggcgagcacggtgtcgggcgcgagaagatcaaccag
atgtgcgtgcagttcaacgccgacgaaatcacgttcttccacgcggtgaaggccgcattc
gatccgcaggggctgctcaatcccggcaagaacatcccgacgctgcaccgctgcgccgaa
ttcggcgcaatgcacgtccatcacggcaagctgccgtttcccgaactggagcgcttctga

DBGET integrated database retrieval system