KEGG   Burkholderia cepacia DDS 7H-2: DM42_5178Help
Entry
DM42_5178         CDS       T03302                                 

Definition
(GenBank) binding--dependent transport system inner membrane component family protein
  KO
K02026  multiple sugar transport system permease protein
Organism
bced  Burkholderia cepacia DDS 7H-2
Brite
KEGG Orthology (KO) [BR:bced00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bced02000]
    DM42_5178
Transporters [BR:bced02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Putative multiple sugar transporter
    DM42_5178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 O-antigen_lig
Motif
Other DBs
NCBI-ProteinID: AIO44307
UniProt: A0A095EDU4
LinkDB All DBs
Position
2:complement(1821462..1822313)
Genome map
AA seq 283 aa AA seqDB search
MFPTPVAHWKPVSRRLYKLSLPVALVIWLLPMIAVFVTSVRSTEELVEGHYWGWPRRFAM
IENYRDALTTSPMLHYFWNSVQITVPSVIGSIALAAMAGFALATYRFRGNTALFGTFVAG
NFVPVQVLMIPVRDLSLRLGVFNTVEALILFHVAFQTGFCTLFLRNFIKQLPFELIEAAR
IEGAGEWTVFWRIVLPLIRPALAALAILVFTFVWNDYFWALCLTQGDEAAPITAGVAALK
GQWTTSWNLVSAGSILAALPSVAMFFAMQKHFVAGLTFGATKG
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtttccgacacccgttgcccactggaagccggtatcgcgccggctgtacaagctgtcg
ctgcccgtcgcgctcgtgatctggctgctgccgatgatcgcggtgttcgtcacgtcggtg
cgctcgacggaggaactcgtcgagggccactactggggctggccgcgccgcttcgcgatg
atcgagaactatcgcgatgcgctgaccacgtcgccgatgctgcattacttctggaacagc
gtgcagatcaccgtgccgtcggtcatcggctcgatcgcgctcgcggcgatggccggcttc
gcgctcgcgacctaccggtttcgcggcaataccgcgctgttcggcacgttcgtcgccggc
aacttcgtgccggtgcaggtgctgatgattccggtgcgcgacctgtcgctgcggctcggc
gtgttcaataccgtcgaagcgctgatcctgttccacgtcgcatttcagacggggttctgc
acgctgttcctgcgcaacttcatcaagcagctgccgttcgagctgatcgaggcggcgcgc
atcgaaggcgcgggcgaatggacggtgttctggcggatcgtgctgccgctgatccggccg
gcgctggccgcgctcgcgattctcgtgttcacgttcgtgtggaacgattacttctgggcg
ctgtgccttacgcaaggcgacgaggcggcgccgatcacggcgggcgtcgccgcgctgaaa
ggtcaatggacgacttcgtggaacctcgtctcggccgggtcgattctcgccgcgctgccg
tcggtcgcgatgttcttcgcaatgcagaagcatttcgtcgcggggctcacgttcggcgcg
acgaaaggctga

DBGET integrated database retrieval system