KEGG   Burkholderia cepacia DDS 7H-2: DM42_5204Help
Entry
DM42_5204         CDS       T03302                                 

Definition
(GenBank) aminotransferase class-III family protein
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
bced  Burkholderia cepacia DDS 7H-2
Pathway
bced00860  Porphyrin and chlorophyll metabolism
bced01100  Metabolic pathways
bced01110  Biosynthesis of secondary metabolites
bced01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bced00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DM42_5204
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bced01007]
    DM42_5204
Enzymes [BR:bced01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     DM42_5204
Amino acid related enzymes [BR:bced01007]
 Aminotransferase (transaminase)
  Class III
   DM42_5204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AIO45381
UniProt: A0A095FCI7
LinkDB All DBs
Position
2:complement(1852555..1853913)
Genome map
AA seq 452 aa AA seqDB search
MPTRHGVDLIRARALFDRERQTFTEAMPVSRALSAEASEHLLFGVPLHWMQDWSTPFSLY
VKEARGATFTDVDGHRYVDFCLGDTGAMFGHAPEPVARALVEQATRGYTTMLPSEDAAWV
SRELARRFKLPVWQFALSASDANRFVLRWARAATGRNTIVVFNGCYHGTVDDVFVDLVDG
RPVQRDSLLGQSYDLLANTRVIEFNDLAALEAALQDGDVACVLAEPAMTNIGMVLPDPGF
WEAARELTRRTGTLLVIDETHTISSGPGGYAVAHGLEPDMLVVGKPIAGGVPCAVYGFSA
EFAARAKQAKLNAPPGHSGIGTTLTANMLAMHAMRATLAEVATDAAYAHMFALAARLATG
LEHAIATHRLPWCVTRIGARTEFQFAPVPPRNGTLAGAQLDSELEHIVHLYLLNRGVLIT
PFHNMMLVCPQTTDDDVDRLVAQFDACLGELV
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
ttgcctacccgccacggagtcgacctcatccgcgcccgcgcgctgttcgatcgcgaacgc
cagacgttcaccgaagccatgccggtttcccgcgcgctgtccgcggaagcgtccgagcac
ttgctgttcggcgtgccgttgcactggatgcaggactggtcgaccccgttctcgctctac
gtgaaggaagcccgcggcgcgacgtttaccgacgtcgacggtcatcgctacgtcgatttc
tgcctcggcgacaccggcgcgatgttcggccatgcgcccgaacccgtcgcccgcgcgctc
gtcgaacaggccacgcgcggctacacgacgatgctgccgagcgaggacgccgcgtgggtg
tcgcgcgaactcgcgcggcgcttcaagttgccggtctggcaattcgcgttgagcgcgagc
gacgcgaaccgcttcgtgctgcgctgggcgcgcgcggccaccggccgcaacacgatcgtc
gtgttcaacggctgttatcacggcacggtcgacgacgtgttcgtcgatctcgtcgacggc
cgcccggtacagcgcgacagcctgctcgggcagtcgtacgacctgctcgcgaacacgcgc
gtcatcgagttcaacgatctggccgcgctcgaagcggcgctgcaggacggcgatgtcgcg
tgcgtgctcgcggagcccgcgatgacgaacatcggcatggtgctgcccgacccgggtttc
tgggaagccgcgcgcgaactgacgcgccgcaccggcacgctgctggtgatcgacgagacg
cacacgatcagcagcggccccggcggttacgcggtcgcgcacggtctcgaaccggacatg
ctggtggtcggcaagccgatcgcgggcggcgtgccgtgcgcggtgtacgggttcagcgcc
gaattcgcggcgcgcgccaagcaggcgaagctgaacgcgccgcccggccactcgggcatc
ggcacgacgctcaccgcgaacatgctcgcgatgcatgcgatgcgcgcgacgctcgccgaa
gtcgcgaccgacgccgcgtatgcgcacatgttcgcactcgccgcgcggctcgcgacgggc
ctcgaacacgcgatcgcgacacaccggctgccgtggtgcgtgacgcgcatcggcgcgcgc
accgagtttcagttcgcgccggtgccgccgcgcaacggcacgctggccggcgcgcagctc
gacagcgaactcgagcacatcgtgcacctgtacctgctgaatcgcggcgtgctgatcacg
cccttccacaacatgatgctcgtgtgcccgcaaacgaccgacgacgatgtcgaccggctc
gtcgcgcagttcgatgcgtgtctgggtgagctggtgtga

DBGET integrated database retrieval system