KEGG   Burkholderia cepacia DDS 7H-2: DM42_5225Help
Entry
DM42_5225         CDS       T03302                                 

Definition
(GenBank) secretory lipase family protein
Organism
bced  Burkholderia cepacia DDS 7H-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LIP Abhydrolase_1
Motif
Other DBs
NCBI-ProteinID: AIO46592
UniProt: A0A095F7K3
LinkDB All DBs
Position
2:1873748..1875064
Genome map
AA seq 438 aa AA seqDB search
MSSRRFMMAAAAVSAALAVAAPPAGAAAPAVSDPFYTYTGTTPLASVPPGTVVKTRNVTY
HVAGMPTAVTAQQLLYRTHNALNQPVVNVTSVIRSPVSNGRAISYQSAYDSLNPYDEPSQ
VIAGDRDVTKVINVGTLLYSAESIPLATLLLLGYNVIVPDTEGQTADFAAGPEYGMTTLD
SIRAALNTPSTGLNPSSKVAMIGYSGGAIATNWAAQLAPSYAPDVNRQLVGAAEGGVLVD
PAHNLRYVDGSIVWGGVAAAALAGLSRGYGFDLTPYLSETGVAVFKDIQSQSLAYILPKY
TGLRWGTLFKPQYANDINSIPVYVTYANKVNAGLAASPTIPMFIGQGTAGALDGTFGSQV
GDGVMLAYDVRALAQKFCASGTAVTYTEYPLEHVGAIVPWVAGMLPWLYDRFNGKAAPNN
CWLTSLLPSNSLAPETLH
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccagacgtttcatgatggccgcggccgcggtgtcggccgcactggccgtcgcc
gcaccgccggccggcgccgccgcaccggccgtttccgatccgttctatacatacaccggc
accacgccgctggcatcggttccaccgggcaccgtggtcaagacgcgcaacgtcacctat
cacgtggccggcatgccgaccgcggtgaccgcgcagcagctgctgtatcgcacccacaac
gcgctgaaccagccggtcgtcaacgtgacgtcggtgatccgcagcccggtcagcaacggc
cgggcgatctcgtaccagtcggcctacgattcgctgaacccgtacgacgaaccgtcgcag
gtgatcgccggcgaccgcgacgtgaccaaggtgatcaacgtcggcacgttgctgtacagc
gcggaatcgattccgctggcgacgctgctgctgctcggctacaacgtcatcgtgcccgat
accgagggccagacggccgatttcgcggccggccccgaatacgggatgacgacgctcgat
tcgatccgcgcggcgctcaatacgccgtcgaccgggctgaatccgtcgagcaaggttgcg
atgatcggctattccggcggcgcgatcgcgaccaactgggccgcgcaactcgcgccgagc
tatgcgcccgacgtcaaccggcagctcgtcggtgcggcggaaggcggcgtgctggtcgat
ccggcgcacaacctgcgttatgtcgacggcagcatcgtgtggggcggcgtcgccgcggcc
gcgctggcggggctgtcgcgtggctacggtttcgacctgacgccgtacctcagcgagacg
ggcgtcgccgtgttcaaggacatccagagccagtcgctcgcgtacatcctgccgaagtac
acgggcctgcgctggggcacgctgttcaagccgcaatacgcgaacgacatcaacagcatt
ccggtgtacgtcacctatgcgaacaaggtgaacgcggggctggccgcgtcgccgacgatc
ccgatgttcatcggccagggcaccgcgggcgcgctggacggcacgttcggcagccaggtg
ggcgacggcgtgatgctcgcgtacgacgtgcgcgcgctggcgcagaaattctgcgccagc
ggcacggcggtcacgtacaccgagtatccgctcgaacacgtgggcgcgatcgtgccgtgg
gtggcgggcatgctgccgtggctctacgaccgcttcaacggcaaagccgcgccgaacaat
tgctggctgacgtcgctgctgccgagcaattcgctcgcgcccgagacgctgcactag

DBGET integrated database retrieval system