KEGG   Burkholderia cepacia DDS 7H-2: DM42_5229Help
Entry
DM42_5229         CDS       T03302                                 

Definition
(GenBank) peroxiredoxin, Ohr subfamily protein
Organism
bced  Burkholderia cepacia DDS 7H-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OsmC
Motif
Other DBs
NCBI-ProteinID: AIO45373
UniProt: A0A095F573
LinkDB All DBs
Position
2:complement(1878095..1878610)
Genome map
AA seq 171 aa AA seqDB search
MTPLRPPPLSLLDRYRGREPQTLYSTTVTVTGGAAEHGRASGVARSDDGRLDVELRLPSA
LGGPGDGPNPEQLFAASYAACFHGALSLLAARAGVSIAGASVSASIDFCRDPMDGLFMLN
ANIRVRLPGVERAVAEELVRNTERFSPYTKMAHEGISHVVALAPTDDAHER
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgctgcgcccgccgccgctctcgctgctcgaccggtatcgcggacgagaaccg
cagacgctgtactcgacgacggtgaccgtcacgggcggcgcggcggagcatggccgcgca
tcgggcgtcgcgcgttccgacgacgggcggctcgatgtcgagctgcgcctgccgtccgcg
ctcggcgggcccggcgacggccccaatccggagcagttgttcgccgccagctatgcggcg
tgctttcatggcgcgctgagcctgctggccgcacgggcgggggtgtcgatcgccggtgcc
tcggtgtccgcatcgatcgacttctgccgcgatccgatggacggactgttcatgctgaac
gcgaacattcgcgtgcggctgccgggcgtcgaacgcgcggtggcggaagaactcgtccgc
aacaccgagcgtttcagtccgtatacgaagatggcgcacgaagggatcagccacgtggtg
gcgctggcgccgacggacgatgcgcacgaacgctaa

DBGET integrated database retrieval system