KEGG   Burkholderia cepacia DDS 7H-2: DM42_5263Help
Entry
DM42_5263         CDS       T03302                                 

Definition
(GenBank) putative chromosome partitioning protein, ATP-binding subunit
Organism
bced  Burkholderia cepacia DDS 7H-2
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AIO45829
UniProt: A0A095F6C5
LinkDB All DBs
Position
2:complement(1910787..1911056)
Genome map
AA seq 89 aa AA seqDB search
MRTTGSSGAMTLLTEHDPADGRELRSLRLEATGDGKSVLLIEIDERKPGIHREVRYEITP
AELIAAIRSHGAELPGENHGAASLARTPS
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgcgcactaccggctcatccggggcaatgaccctgctcaccgaacacgacccggccgac
ggccgcgaactgcgctcgctccggctcgaagcgaccggcgacggcaagagcgtgctgctg
atcgagatcgacgaacgcaagcccggcatccatcgcgaggtccgctacgagatcacgccg
gccgaactgatcgcggcgatccgctcgcacggcgccgagttgcccggcgaaaaccatggc
gccgcctcgctcgcccgcacgccttcctga

DBGET integrated database retrieval system