KEGG   Burkholderia cepacia DDS 7H-2: DM42_5310Help
Entry
DM42_5310         CDS       T03302                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bced  Burkholderia cepacia DDS 7H-2
Pathway
bced00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bced00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DM42_5310
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bced02000]
    DM42_5310
Enzymes [BR:bced01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     DM42_5310
Transporters [BR:bced02000]
 Other Transporters
  Pores ion channels [TC:1]
   DM42_5310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_C_2 GST_N_2 GST_C Glutaredoxin GST_C_3
Motif
Other DBs
NCBI-ProteinID: AIO45133
UniProt: A0A095E8T5
LinkDB All DBs
Position
2:1967919..1968578
Genome map
AA seq 219 aa AA seqDB search
MMPTLYAHPFSSYCQKVLTALYENGTPFDYRVLAHDDPKPMQELAALWPLKRFPVLVDAG
RTVIEASIIIEYLGLNHPGPVRLLPDDPRAALEVRTMDRFFDNYVATPQQKVVFDALRPE
AERDARGVADARAMLETSYAWLDRTMAEREWAAGDHFSLADCGAAPFLFYADWTHRIDPA
FANVIAYRQRLLARPSFARAVDEARPYRSFFPLGAPDRD
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgacgctttacgcccatcccttttcgtcctactgccagaaggtgctgaccgcg
ctatacgagaacggcacgccgttcgactatcgcgtgctcgcgcacgacgacccgaagccg
atgcaggaactggccgcgctgtggccgctgaagcgcttcccggtgctcgtcgacgcgggc
cgcacggtgatcgaggcgtcgatcatcatcgaatatctcggcctgaaccatccgggcccg
gtgcgtctgctgcccgacgatccgcgcgccgcgctcgaggtgcggacgatggaccgcttc
ttcgacaactacgtggcgacgccgcagcagaaggtcgtgttcgatgcgctgcggccggaa
gccgagcgcgatgcgcgcggggtggccgatgcgcgcgcgatgctcgagacgtcgtatgcg
tggctcgacaggacgatggccgagcgcgaatgggcggccggcgaccatttcagcctcgcc
gattgcggcgcggcgccgttcctgttctacgcggactggacgcaccggatcgatccggcg
ttcgcgaacgtgatcgcgtaccgccagcgtctgctcgcgcggccgtcgtttgcgcgggcg
gtcgacgaggcgcggccgtatcgttcgttctttccgctcggtgcacctgatcgcgactga

DBGET integrated database retrieval system