KEGG   Burkholderia cepacia DDS 7H-2: DM42_5413Help
Entry
DM42_5413         CDS       T03302                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bced  Burkholderia cepacia DDS 7H-2
Pathway
bced00250  Alanine, aspartate and glutamate metabolism
bced00410  beta-Alanine metabolism
bced00640  Propanoate metabolism
bced00650  Butanoate metabolism
bced01100  Metabolic pathways
bced01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bced00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    DM42_5413 (gabT)
   00650 Butanoate metabolism
    DM42_5413 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DM42_5413 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DM42_5413 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bced01007]
    DM42_5413 (gabT)
Enzymes [BR:bced01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     DM42_5413 (gabT)
Amino acid related enzymes [BR:bced01007]
 Aminotransferase (transaminase)
  Class III
   DM42_5413 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AIO44502
UniProt: A0A095E8C9
LinkDB All DBs
Position
2:complement(2075260..2076543)
Genome map
AA seq 427 aa AA seqDB search
MKNADLQARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRHPK
IVKAIADQLNSFTHTAYQIVPYASYVELAEKINERAPGDFPKKTAFFTTGAEAVENAIKI
ARAATGRPGVIAFSGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNALHGVTTA
DSIKAIEMLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVRALRKICNEHGILLIADEV
QTGFARTGKLFAMQHYDVLADLITMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYAGN
PLAVASAHAVLEIIDEEKLCERATQLGDVLKAKLNALQADVPQIADVRGPGAMIAVEFLK
PGSGEPDAEFTKRVQARVLERGLLLLVCGVYSNVVRFLFPLTIPQAVFDEALVILEEVLK
ETVGVPA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaatgccgacctgcaggcccgcaagaacgccgccaccccgcgcggcgtcggcgtg
atgtgcgatttctacgccgcccgcgccgagaacgcggagctgtgggatgtcgaaggccgc
cgcttcatcgatttcgccgccggcatcgcggtgctgaacacgggccaccgccacccgaag
atcgtcaaggcgatcgcggatcaactgaacagcttcacgcacaccgcttaccagatcgtc
ccgtacgcgtcgtacgtcgagctggcggaaaagatcaacgaacgcgcgccgggcgacttc
ccgaagaagaccgcgttcttcacgaccggcgccgaagccgtcgagaacgcgatcaagatc
gcacgtgcggcgaccggccgtccgggcgtgatcgcattctcgggcggcttccacggccgc
acgatgatgggcatggcgctgaccggcaaggtcgccccgtacaagctgaacttcggcccg
ttcccgggcgacgtgttccacgcgccgtacccgaacgcactgcacggcgtgacgacggcc
gactcgatcaaggcgatcgagatgctgttcaaggccgacatcgatccgaagcgcgtcgcc
gcgatcatcttcgaaccggtccagggcgaaggcggcttcaacccggcgccggccgaattc
gtgcgcgcgctgcgcaagatctgtaacgaacacggcatcctgctgatcgccgacgaagtg
cagacgggcttcgcacgtaccggcaagctgttcgcgatgcagcactacgacgtgctggcc
gacctgatcacgatggcgaagagcctcgcgggcggcatgccgctgtcgggcgtcgtcggc
cgtgcggacgtgatggacgcggccgcccccggcggcctcggcggcacctacgcgggcaac
ccgctggcggtcgcgtcggcgcacgcggtgctcgagatcatcgacgaagagaagctgtgc
gagcgcgcgacgcaactcggcgacgtgctgaaggcgaagctgaacgcgctgcaggccgac
gtgccgcagatcgccgacgtgcgcggcccgggcgcgatgatcgcggtcgaattcctgaag
ccgggttcgggcgagccggatgccgaattcacgaagcgcgtgcaggcgcgtgtgctcgag
cgcggcctgctgctgctcgtgtgcggcgtgtactcgaacgtcgtgcgcttcctgttcccg
ctgacgatcccgcaagccgtgttcgacgaagcgctcgtgatcctcgaggaagtgctgaag
gaaacggtcggcgtgccggcctga

DBGET integrated database retrieval system