KEGG   Burkholderia cepacia DDS 7H-2: DM42_5757Help
Entry
DM42_5757         CDS       T03302                                 

Gene name
dgdA
Definition
(GenBank) 2,2-dialkylglycine decarboxylase
  KO
K00596  2,2-dialkylglycine decarboxylase (pyruvate) [EC:4.1.1.64]
Organism
bced  Burkholderia cepacia DDS 7H-2
Brite
KEGG Orthology (KO) [BR:bced00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bced01007]
    DM42_5757 (dgdA)
Enzymes [BR:bced01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.64  2,2-dialkylglycine decarboxylase (pyruvate)
     DM42_5757 (dgdA)
Amino acid related enzymes [BR:bced01007]
 Aminotransferase (transaminase)
  Class III
   DM42_5757 (dgdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AIO46181
UniProt: A0A095E972
LinkDB All DBs
Structure
PDB: 

Position
2:complement(2472238..2473539)
Genome map
AA seq 433 aa AA seqDB search
MSLNDDATFWRNAKQHLVRYGGTFEPVIIERAKGSFVYDADGRAILDFTSGQMSAVLGHS
HPEIVSVIGEYAGKLDHLFSGMLSRPVVDLATRLADLTPAGLDRALLLSTGAESNEAAIR
MAKLVTGKYEIVGFAQSWHGMTGAAASATYSAGRKGVGPASVGSFAIPAPFAYRPRFERN
GAYDPLAELDYAFDLIDRQSSGNLAAFIAEPILSSGGIIELPEGYMAALKRKCEERGMLL
ILDEAQTGVGRTGTMFACQRDGVTPDILTLSKTLGAGLPLAAMVTSAAIEERAHALGYLF
YTTHVSDPLPAAVGLRVLDVVQRDGLVARANTMGERLRRGLLDLMERFDCIGDVRGRGLL
LGVEIVKDRRTREPADGLGAKITRECMNLGLSMNIVQLPGMGGVFRIAPPLTVSDEEIDL
GLSLLEQAITRAL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgaacgacgatgcaaccttctggcgcaacgccaagcagcacctggtccgctac
ggcggcacgttcgaaccggtgatcatcgagcgcgcgaaaggcagcttcgtctacgacgcc
gatggccgcgcgatcctcgatttcacgtcgggccagatgagcgcggtgctcggccacagc
catccggagatcgtctccgtgatcggcgaatacgcgggcaagctcgaccacctgttcagc
gggatgctgtcgcggccggtcgtcgatctcgcgacgcgcctcgccgacctcacgcccgcc
ggcctcgaccgcgcgctgctgctcagcaccggcgcggaatcgaacgaggcggcgatccgg
atggcgaagctcgtcaccggcaagtacgagatcgtcggcttcgcgcagtcgtggcacggg
atgacgggcgccgccgcgtcggccacgtacagcgccggccgcaagggcgtcggccccgcg
tcggtcggctcgttcgcgattccggcgccgttcgcgtaccggccgcgcttcgagcgcaac
ggtgcgtacgatccgctcgccgaactcgactacgcgttcgacctgatcgaccgccagtcg
agcggcaacctcgccgcgttcatcgcggagccgatcctcagttcgggcggaatcatcgaa
ttgccggaaggctatatggccgcgctcaagcgcaagtgcgaggaacgcgggatgctgctg
atcctcgacgaggcgcagacgggcgtcggccgcaccggcacgatgttcgcgtgccagcgc
gacggcgtgacgcccgacatcctgacgctgtcgaagacgctcggcgcggggctgccgctc
gcggcgatggtcacgtccgcggccatcgaggaacgcgcgcacgcgctcggctacctgttc
tacacgacgcacgtgtccgacccgctgccggcggcggtcggcctgcgcgtgctcgacgtc
gtgcagcgcgacggcctcgtcgcgcgcgccaacacgatgggcgagcggctgcggcgcggc
ctgctcgacctgatggagcgcttcgactgcatcggcgacgtacgcgggcgcgggctgctg
ctcggcgtcgagatcgtcaaggatcgccgcaccagggagccggcggacgggctcggtgcg
aagatcacgcgcgagtgcatgaacctcgggctcagcatgaacatcgtgcagttgcccggc
atgggcggcgtgttccggatcgcgccgccgctgaccgtcagcgacgaagagatcgacctc
gggctgtcgctgctggagcaggcgatcacgcgcgcgctgtaa

DBGET integrated database retrieval system