KEGG   Burkholderia cepacia DDS 7H-2: DM42_5986Help
Entry
DM42_5986         CDS       T03302                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
bced  Burkholderia cepacia DDS 7H-2
Brite
KEGG Orthology (KO) [BR:bced00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DM42_5986
Enzymes [BR:bced01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     DM42_5986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Spermine_synth ADH_zinc_N_2 NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: AIO44000
UniProt: A0A095GKR4
LinkDB All DBs
Position
2:2765628..2766716
Genome map
AA seq 362 aa AA seqDB search
MTTPEAQPRMTAVVCHGPEDYRVEQVAKPNPGVNELVIRIAACGICASDCKCYTGAKMFW
GGPSPWVKAPVIPGHEFFGYVEALGDGAAEHFGVALGDRVIAEQIVPCGKCRYCKSGQYW
MCEVHNIFGFQREVADGGMAEYMRIPPTAIVHRIPLGVSLEDAAIIEPLSCAIHTVNRGD
VQLDDVVVIAGAGPLGLMMTQVAHLKTPKKLVVIDLIDERLELARQYGADVTINPKRDDA
REIVRALTDGYGCDVYIETTGAPVGVNQGLDLIRKLGRFVEFSVFGEDATVDWSIIGDRK
ELDVRGAHLGPYCYPVAIDLLARGLVTSKGIVTHGFALEDWDDAIRVAKSPESIKVLLKP
AR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgacgacacccgaagcccagccgcgcatgaccgcggtcgtctgccacggccccgaggac
tatcgcgtcgaacaggtcgcgaagccgaatcccggcgtgaacgagctcgtgatccgcatc
gccgcgtgcgggatctgcgcgagcgactgcaagtgctacaccggcgccaagatgttctgg
ggcggccccagcccgtgggtgaaggcgccggtgattcccggccatgaattcttcggctac
gtcgaagcgctcggcgacggcgcggccgagcatttcggcgtcgcgctgggcgaccgcgtg
atcgccgagcagatcgtgccgtgcggcaagtgccgctactgcaagtcgggccagtactgg
atgtgcgaagtgcacaacatcttcggctttcagcgcgaggtggccgacggcgggatggcc
gagtacatgcgcattccgccgaccgcgatcgtccacaggattccgctcggcgtatcgctc
gaggatgcggcgatcatcgagccgctgtcgtgcgcgatccacacagtgaaccgcggcgac
gtgcagctcgacgacgtcgtcgtgatcgcgggcgcgggcccgctcgggctgatgatgacg
caggtcgcgcacctgaagacgccgaagaagctcgtcgtgatcgacctgatcgacgaacgg
ctcgagctcgcgcggcagtatggcgccgacgtgacgatcaacccgaagcgcgacgacgcg
cgcgagatcgtccgcgcgctcaccgacggctatggctgcgacgtgtacatcgagacgacc
ggcgcgccggtcggcgtgaaccaggggctcgacctgatccgcaagctcggccgcttcgtc
gagttcagcgtgttcggcgaggatgcgaccgtcgactggtcgatcatcggcgaccgcaag
gagctcgacgtacgcggcgcgcacctcgggccatactgctatccggtcgcgatcgacctg
ctcgcgcgcgggctcgtcacgtcgaaaggcatcgtcacgcacggtttcgcgctcgaggac
tgggacgacgcgatccgcgtcgcgaaatcgcccgaatcgatcaaggtgctgctgaagccg
gcccgctga

DBGET integrated database retrieval system