KEGG   Burkholderia cepacia DDS 7H-2: DM42_6324Help
Entry
DM42_6324         CDS       T03302                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bced  Burkholderia cepacia DDS 7H-2
Pathway
bced00071  Fatty acid degradation
bced00280  Valine, leucine and isoleucine degradation
bced00281  Geraniol degradation
bced00310  Lysine degradation
bced00360  Phenylalanine metabolism
bced00362  Benzoate degradation
bced00380  Tryptophan metabolism
bced00410  beta-Alanine metabolism
bced00627  Aminobenzoate degradation
bced00640  Propanoate metabolism
bced00650  Butanoate metabolism
bced00903  Limonene and pinene degradation
bced00930  Caprolactam degradation
bced01100  Metabolic pathways
bced01110  Biosynthesis of secondary metabolites
bced01120  Microbial metabolism in diverse environments
bced01130  Biosynthesis of antibiotics
bced01212  Fatty acid metabolism
Module
bced_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bced00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    DM42_6324
   00650 Butanoate metabolism
    DM42_6324
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DM42_6324
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DM42_6324
   00310 Lysine degradation
    DM42_6324
   00360 Phenylalanine metabolism
    DM42_6324
   00380 Tryptophan metabolism
    DM42_6324
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DM42_6324
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    DM42_6324
   00281 Geraniol degradation
    DM42_6324
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DM42_6324
   00627 Aminobenzoate degradation
    DM42_6324
   00930 Caprolactam degradation
    DM42_6324
Enzymes [BR:bced01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     DM42_6324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AIO44383
UniProt: A0A095E4H5
LinkDB All DBs
Position
2:3139240..3140160
Genome map
AA seq 306 aa AA seqDB search
MEATRMTFGDGVVDYALEDGIATITMNRPDYHNAQNSKMTYALDAAFRRAAHDDAVKAIV
LAGAGKHFSAGHDIGTPGRDIHESFERASLWYDHVDKAGGEFLYAREQEVYLGMCRRWRD
LPKPTIAMVQGACIAGGLMLAWVCDLIVASEDAFFADPVVRMGIPGVEYFAHAYELNPRI
AKEFLFLGERMPAERAYQMGMVNRVVPRERLRDATYAIAAKIATMPRLGLTLTKQALNHV
EELQGKRAAMDAAFAWHHFAHAHNELVSGDRLGGYDARSMASSQRQPNGADRADAPAPVA
VNGAAA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgacccggatgacgttcggcgacggtgtcgtcgactacgcgctcgaggacggc
atcgcgacgatcacgatgaaccgccccgactatcacaacgcgcagaactcgaagatgacg
tatgcgctcgacgcggcgttccggcgcgcggcgcacgacgacgcggtgaaggcgatcgtg
ctcgcgggcgccggcaagcatttctcggccggtcacgacatcggcacgccgggccgcgac
atccacgagtcgttcgagcgcgcgtcgctgtggtacgaccacgtcgacaaggcaggcggc
gaattcctctatgcgcgcgagcaggaggtgtatctcggcatgtgccggcgctggcgcgac
ctgccgaagccgacgatcgcgatggtgcagggcgcgtgcatcgccggcgggctgatgctc
gcgtgggtgtgcgacctgatcgtcgcgtcggaggatgcgttctttgccgatccggtcgtg
cggatggggattccgggcgtcgagtatttcgcccacgcgtacgagctgaatccgcgcatc
gcgaaggaattcctgtttctcggcgagcggatgccggccgagcgcgcgtaccagatgggg
atggtcaaccgcgtggtgccgcgcgagcggctgcgcgacgcgacctacgcgatcgccgcg
aagatcgcgacgatgccgcgcctcgggctcacgctgaccaagcaggcgctgaatcacgtc
gaggaactgcaaggcaagcgcgcggcgatggacgcggcgttcgcgtggcatcacttcgcg
catgcgcacaacgagctcgtcagcggcgaccgcctcggcggttacgacgcccgcagcatg
gcgagctcgcaacgccagccgaacggcgcggaccgcgcggacgcgccggcaccggtcgcc
gtcaacggagccgccgcatga

DBGET integrated database retrieval system