KEGG   Burkholderia cepacia DDS 7H-2: DM42_6548Help
Entry
DM42_6548         CDS       T03302                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bced  Burkholderia cepacia DDS 7H-2
Pathway
bced00010  Glycolysis / Gluconeogenesis
bced00071  Fatty acid degradation
bced00350  Tyrosine metabolism
bced00625  Chloroalkane and chloroalkene degradation
bced00626  Naphthalene degradation
bced01100  Metabolic pathways
bced01110  Biosynthesis of secondary metabolites
bced01120  Microbial metabolism in diverse environments
bced01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bced00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DM42_6548
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DM42_6548
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    DM42_6548
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DM42_6548
   00626 Naphthalene degradation
    DM42_6548
Enzymes [BR:bced01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DM42_6548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: AIO43887
UniProt: A0A095GUV8
LinkDB All DBs
Position
3:183909..184955
Genome map
AA seq 348 aa AA seqDB search
MTNQATYRAAVVKAPGQLELVERPIPAPAQGQVRIRVEACGVCHSDSATVEREAPDGAPP
RVPGHEVVGRIDALGEGVSGWRLGERVGVGFLAGEDRTCPSCRHGDVVNCENPVITGMTT
DGGYAEIMLAEARGLVRVPDDLDAAEAAPLLCAGLTTFNALRNAGARAGDVVAIHGLGGL
GHLAVQFANKMGFHTVVIARGADKAALAAQLGAHRYIDARTEDVAAALRALGGAKVVLGT
APTGSGMADTVAGLSVRGKLIVVAVPGEPIAVNAVDLVFGGRSVVGALTGTVTDNEETLA
FARLQNVRPMIETFPLEQAQAAYDRMMRADVRFRAVLTMNYASNGASA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatcaagcgacttaccgcgcggcggtagtcaaggcgcctgggcaactggaactg
gtcgagcggccgattcccgcgcctgcgcaggggcaggtgcgcattcgcgtcgaagcctgc
ggcgtatgccattccgacagcgcaaccgtggagcgcgaagcgcctgacggcgcgccgccg
cgcgtaccggggcatgaagtcgtcggccgaatcgacgcgctcggcgaaggggtgtccggc
tggcggctcggcgaacgtgtcggcgtcggctttctcgccggcgaagatcgcacgtgcccg
tcgtgccggcacggcgatgtcgtgaactgcgagaacccggtcatcaccgggatgacgacg
gacggcggctacgcggaaatcatgctggccgaagctcgcgggctcgtgcgcgtgccggac
gatctcgacgcggccgaggctgcgccgctgttgtgcgcggggctcaccacgttcaacgcg
ctgcgcaatgccggcgcgcgggccggcgacgtggtcgccatccatggcctcggcgggctc
ggccatctcgccgtgcagttcgcgaacaagatgggttttcacaccgtcgtgatcgcccgc
ggagccgacaaggccgcgcttgccgcgcagctcggcgcgcatcgctacatcgacgcgcgg
accgaggacgtggccgctgcgctgcgcgcgctcggcggcgcgaaggtcgtgctcggcacg
gcgccgacgggctcgggcatggccgacaccgtcgcgggcctgtccgtgcgcggcaagctg
atcgtcgttgccgtgccgggcgagccgatcgccgtgaatgcggtcgatctcgtgttcggc
ggccgctccgtggtcggcgcattgacgggaacggtgacggacaacgaagagacgctcgcg
ttcgcgcggctgcagaacgtgcggccgatgatcgaaacgtttccgctcgagcaggcgcag
gcggcatacgaccgcatgatgcgcgcggatgtccggttccgcgcggtactgaccatgaat
tacgcatccaacggagcttccgcatga

DBGET integrated database retrieval system