KEGG   Burkholderia cepacia DDS 7H-2: DM42_6946
Entry
DM42_6946         CDS       T03302                                 

Definition
(GenBank) AMP-binding enzyme family protein
  KO
K03397  indoleacetate---lysine synthetase [EC:6.3.2.20]
Organism
bced  Burkholderia cepacia DDS 7H-2
Brite
KEGG Orthology (KO) [BR:bced00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DM42_6946
Enzymes [BR:bced01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.20  indoleacetate---lysine synthetase
     DM42_6946
SSDB
Motif
Pfam: AMP-binding
Other DBs
NCBI-ProteinID: AIO43677
UniProt: A0A095EKQ0
LinkDB
Position
3:complement(643974..645209)
AA seq 411 aa
MSERTTRFDSSAVSEALSYDARYADLLPTGVASYAAFRALVGIETADDLKRRVLERLEHG
DLAGATFYTTSGTSGEVKLLLNAPARKRPDATYGRALANALAGTAIAPTDRVANLFTAGG
FSTLYDGVNRLLEAIGANVLPIGRLDAYGADLPAMLNLIGRVRPNVLVGTPTSVLQCLRL
LDAYGVDLDVTTILYTGEAFSGHKREIVRRRWRDAAFFGLYGATETGFLGYHTPRCAEGH
YHVLDDWFFLEEEDGQLLVTSRANPGLAMLRYRIGDRVRVGPAVRCTCGEGGSVVVLQGR
TDQRFKFAGNLISTELLAQRLAACAGRPLDSQFRLAADAHGRDCLTVALDLDDDEFAPLG
PRLTRTLLEIEDVRECIDKGEGRLDVRGRDALRFSARQKLPRLIDERHAHV
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgtccgagcgcacgacccgcttcgattcctccgccgtgagcgaagcgctttcgtacgat
gcccgctatgcggatttactgccgacgggcgtggccagctacgcggccttccgcgcgctg
gtcgggatcgagacggccgacgacctgaagcggcgcgtactggagcgcctcgagcacggc
gatctcgccggcgcgacgttttacaccacgtcgggcacgagcggcgaggtcaagctgctg
ctcaatgcgccggcccgcaagcggcccgacgcgacttatggccgggcgctcgcgaatgcg
ctggcggggacagcgatcgcaccgacggaccgggtggcgaacctgtttaccgccggcggc
ttttccacgctgtacgacggcgtgaaccggttgctggaagcgatcggcgcgaacgtgctt
ccgatcgggcggctggacgcatacggcgccgatcttcccgccatgctgaacctgatcggc
cgcgtgcgccccaacgtgctggtcggcacgccgacgagcgtgctgcaatgcctgcggctg
ctcgacgcgtacggcgtggatctcgacgtgacgacgatcctctacaccggcgaagcattc
tctgggcacaagcgcgagatcgtgcggcggcgctggcgcgatgccgcattcttcggactg
tacggcgccaccgaaacggggtttctcggctatcacacgccgcgctgtgcggaagggcat
taccacgtgctcgacgactggttctttctcgaagaggaggacgggcaactcctcgtgacg
agccgtgccaacccgggcctcgcgatgctgcgctaccggatcggcgatcgcgtgcgcgtc
ggtccggcggtgcgctgtacgtgtggcgagggcggttccgtcgtcgtgctgcagggccgc
acggatcagcgcttcaagttcgcgggcaacctgatcagcacggagctgcttgcgcagcgg
ctcgcggcgtgcgccggccggccgctcgacagtcagtttcgcctggccgccgacgcgcat
ggacgcgattgtctgacggtcgcgctggacctggacgacgatgaattcgcgccgctcggg
ccacggctcacccgtacgctgctcgagatcgaggacgtgcgcgagtgcatcgacaagggc
gaggggcgcctcgacgtgcgcggccgcgatgccttgcgcttctccgcacgccagaagctg
ccgcgcctgatcgacgagaggcacgcccatgtgtga

DBGET integrated database retrieval system